Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR10G9 Olfactory Receptor

Gene Symbol OR10G9
Organism Cow
Family 10
Subfamily G
Pseudo No
Location chr29:***************** (-)
Aliases LOC506981, ENSBTAG00000048222

Sequence information


Nucleotide sequence

ATGACAAACGTGAGCCTAGTGACAACATTCATCCTCACGGGCCTTCCCCATGCACCAGAG
CTGGACACATTCCTCTTTGGAATCTTCCTGGTGATCTATGTCCTCACTTTGGTGGGGAAC
CTACTCATCTTGCTGGTGATTATAGTGAATCCTCACCTGCACACCCCCATGTACTACTTC
CTGAGCAACCTGTCCTTCATTGACATGTGGTACTCCACGGTCACTACACCCAAAATGCTG
ATGACCCTGGTGTCCCCAGAAGGCAGTCTTGTCTCCTTTCCCAGCTGTGTGGCCCAGCTC
TACTCTTTCCACTTCCTGGGCAGCACCGAGTGTTTCCTCTACACCGTCATGTCCTATGAC
CGTTTCCTGGCCATCAGTTACCCACTAAGGTACGCCAGAATGATGAGTGGTAGGACATGT
GCCATCCTGGCCACAACCACGTGGCTCAGTGGCTCTGTGCACTCTGCTGCCCAGACCACA
TTGACGTTCCGTTTGCCCTTCTGTGGACCCAACCAGATCCAGCATTACATCTGTGATGCA
CCACCCATCCTCAAACTGGCCTGTGCAGACACGTCCACCGTGGAGATGGTGATCTTTGTC
AACATTGGGGTGGTGGCCTCAGGTTGCTTTCTCCTGATAGTGCTGTCCTACGTGTCCATC
ATCCATTCCATCCTGAAGATCCGCACCTCAGAGGGAAGGTGGAGAGCCTTCCAGACCTGT
GCCTCCCACTGCGCTGTGGTCCTTTGCTTCTTTGTTCCTTGTGTTTTCATTTACCTGAGA
CCAGGCTCCAAGGAGGTTGTGGACAGCATTGTGGCTGTTTTCTACACTGTGATGACACCC
CTTCTGAACCCTGTGATCTACACCCTGCGGAACAAGGAAGTGAAGAAAGCTCTGTTGAAG
TTTAAAGACAAAGTAGTGTACTCAGAAAGCAAA


Conceptual translation

MTNVSLVTTFILTGLPHAPELDTFLFGIFLVIYVLTLVGNLLILLVIIVNPHLHTPMYYF
LSNLSFIDMWYSTVTTPKMLMTLVSPEGSLVSFPSCVAQLYSFHFLGSTECFLYTVMSYD
RFLAISYPLRYARMMSGRTCAILATTTWLSGSVHSAAQTTLTFRLPFCGPNQIQHYICDA
PPILKLACADTSTVEMVIFVNIGVVASGCFLLIVLSYVSIIHSILKIRTSEGRWRAFQTC
ASHCAVVLCFFVPCVFIYLRPGSKEVVDSIVAVFYTVMTPLLNPVIYTLRNKEVKKALLK
FKDKVVYSESK