Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR10G9E Olfactory Receptor

Gene Symbol OR10G9E
Organism Cow
Family 10
Subfamily G
Pseudo No
Location chr29:26,921,800-26,922,800 (+)

Sequence information


Nucleotide sequence

ATGACTTGTATAATGCAGTTCTCAGGTCTCAATAAAATGTTGGATGCTCTTGATGTTCCC
ATagagagagagagagagagagaCCAAAAGTGTGGAGAAATGACAAACATGAGCCTAGTG
ACAACGTTCATCCTCACAGGCCTTCCCCATTCACCAGAGCTGGACACGCTCCTCTTTGGA
ATCTTCCTGGTGATCTATGCCCTCACTGTGGTGGGGAACCTTCTCATCTTGCTGGTGATC
ACAGTGGATCCCCACCTGCACACCCCCATGTACTACTTCCTGAGCAACCTGTCCTTCATT
GACATGTGGTTCTCCACGGTCACTGTGCCCAAAATGCTGATGACCCTCGTGTCCCCAGAA
GGCAGTCCTATCTCCTTTCCCGGCTGTGTGGCCCAGCTCTACTCCTTCCACTTCCTGGGC
AGCACCGAGTGCTTCCTCTACACCGTCATGTCCTATGACCGTTTCCTGGCCATCAGTTAC
CCGCTCAGGTATGCCAGCGTGATGAGTGGGAGGACGTGTGCCCTCCTGGCCACAACCACG
TGGCTCAGTGGCTCTGTGCACTCTGCTGTCCAGACCACACTGACGTTCCGTTTGCCCTTC
TGTGGACCCAACCAGATCCAGCATTACTTCTGCGATGCACCACCCATCCTCAAACTGACC
TGTGCAGACACCTCTGCCAACGAGGTGGTGATCTTTGTCAACATTGGGGTGGTGGCCTTG
GGCTGTTTTTTCCTGATAGTGCTGTCCTACGTATCCATCATCCATTCCATCCTGAAGATC
CACACCTCAGAAGGGAGATGGAGAGCCTTCCAGACCTGTGCCTCCCACTGCACTGTGGTC
CTTTGCTTCTTTGTTCCCTGTGTTTTCATTTACCTGAGACCAGGCTCCAAGGAGGCTATG
GACAGGATTGTGGCTGTTTTCTACACTGTGATGACGCCCCTTCTGACTCCTGTGGTCTAT
ACCCTGAGGAACAAGGAAGTAAAGAAAGCTCTGTTGACACTTAAAGATAAAGTAGCATAT
TCACAGAGCAAA


Conceptual translation

MTCIMQFSGLNKMLDALDVPIERERERDQKCGEMTNMSLVTTFILTGLPHSPELDTLLFG
IFLVIYALTVVGNLLILLVITVDPHLHTPMYYFLSNLSFIDMWFSTVTVPKMLMTLVSPE
GSPISFPGCVAQLYSFHFLGSTECFLYTVMSYDRFLAISYPLRYASVMSGRTCALLATTT
WLSGSVHSAVQTTLTFRLPFCGPNQIQHYFCDAPPILKLTCADTSANEVVIFVNIGVVAL
GCFFLIVLSYVSIIHSILKIHTSEGRWRAFQTCASHCTVVLCFFVPCVFIYLRPGSKEAM
DRIVAVFYTVMTPLLTPVVYTLRNKEVKKALLTLKDKVAYSQSK