Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR10G9G Olfactory Receptor

Gene Symbol OR10G9G
Organism Cow
Family 10
Subfamily G
Pseudo No
Location chr29:26,987,100-26,988,100 (-)

Sequence information


Nucleotide sequence

ATGCTGGGTGCTCTTGATATTCCCATagagagagagagagagagaAATCAAAAGCCTGGA
GAAATGACGAACATGAGCCTAGTGACAACGTTCGTCCTCACGGGCCTTCCCCATGCACCA
GAGCTGGACACATTCCTCTTTGGAATCTTCCTGGTGATCTATGTCCTCACCGTGGTGGGG
AACTTCCTCATCCTGCTGGTGATTATAGTGAATCCCCACTTGCACACCCCCATGTACTAC
TTCCTAACCAACCTGTCCTTCATTGACATGTGGTACTCCACGGTCACTGTGCCCAAAATG
CTGATGACCCTGGTGTCCCCAGAAGGCAGTCCTATCTCTTTTCATAGCTGTGTGGCCCAG
TTTTACTCCTTTGACTTCCTGGGCAGCACCGAGTGCTTCCTCTACACCGTCATGTCCTAT
GACCGCTTCCTGGCCATCAGTTACCCACTCAGGTACGCCAGCATGATGAGTGGGAGGACT
TGTGCCATCCTGGCCATAACCACGTGGCTCAGTGGCTCTGTGCACTCTGCTGTCCAGACC
ACACCGACATTCCGTTTACCCTTCTGTGGACCCAACCAGATCCAGCATTACATCTGTGAT
GCACCATCTGTACTCAAACTGGCCTGTGCAGACACATCCACCGTGGAGATGGTGATCTTT
GTCAACATTGGGGTGGTGGCCTTGGGCTGTTTTTTCCTGATAGTGCTGTCCTACGTATCC
ATCGTCCATTCCATCCTGAAGATCCGCACCTCAGAGGGGAGATGGAGAGCCTTTCAGACC
TGTGCCTCCCACTGCATTGTGGTCCTTTGTTTCTATGTTCCCCTTGTTTTCATTTACCTG
AGACCAGGCTCCAAGGAGGCTGTGGACAGGATTGTGGCTGTTTTCTACACTGTGATGACA
CCCCTTCTGAACCCTGTGGTCTACACCCTGAGGAACAAGGACGTGAAGAAAGCTCTGCTC
AAGCTTAAAGACAAAGTAATGTATTCACAGAGAAAATGGTCTCTGCAATGTAGACTTGCT
CAT


Conceptual translation

MLGALDIPIERERERNQKPGEMTNMSLVTTFVLTGLPHAPELDTFLFGIFLVIYVLTVVG
NFLILLVIIVNPHLHTPMYYFLTNLSFIDMWYSTVTVPKMLMTLVSPEGSPISFHSCVAQ
FYSFDFLGSTECFLYTVMSYDRFLAISYPLRYASMMSGRTCAILAITTWLSGSVHSAVQT
TPTFRLPFCGPNQIQHYICDAPSVLKLACADTSTVEMVIFVNIGVVALGCFFLIVLSYVS
IVHSILKIRTSEGRWRAFQTCASHCIVVLCFYVPLVFIYLRPGSKEAVDRIVAVFYTVMT
PLLNPVVYTLRNKDVKKALLKLKDKVMYSQRKWSLQCRLAH