Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR10H4H Olfactory Receptor

Gene Symbol OR10H4H
Organism Cow
Family 10
Subfamily H
Pseudo No
Location chr7:8,175,680-8,176,520 (-)

Sequence information


Nucleotide sequence

ATGTACCTGTTCACGCTGCTGGGGAACCTGCTCATCATGGGCACCATCTGGAGGGAGCAC
AGCCTCCACACCCCCATGTACCTCTTCCTGTGTGCCCTCTCCATCTCCGAGATCCTGTTC
ACTGTTGCAGTCACCCCTCGAATGTTGGTGGACATGCTCTCCACCCACCGCTCCATCACC
TTTGTGGCCTGTGCCAGCCAGATGTTCTTCTCCTTCACGTTTGGCTTCACCCACTCCTTC
CTGCTCATGATCATGGGCTACGACCGCTACGTGGCCATCTGCCACCCCCTGCGCTACAAT
GTGCTCATGAGCACCCGTGACTGTGCCCGTCTTGTGTCCTGGTGCTGGGCTGGTGGCTCA
GTCATGGGGATGATGTTGACATTGATAATTTTTCACCTCACCTTCTGTGGGTCTAATGTG
ATTCACCATTTTCTCTGTCACGTGTTTGCCCTCTTGAAGTTGGCTTGTGGAAAGGAGACA
GCCACTGTCTCCATGGCTGTGATTCTGCTTTGTGTCACAGCCCTGATGGGGTGCTTATTC
CTCATTTTCCTCTCCTATGTCTTCATTGTGGCTGCCATCCTGAGGATCCCCTCCGCTGAG
GGCCGGCACAAGACCTTCTCCACCTGTGTCTCCCACCTCACCATAGTGGTCGTGCACTAC
GGTTTTGCCTCCATCATCTACCTCAAGCCCAAAGGCGCCCATTCCATGGACAGTAACACT
CTCATGGCCACCACATATACAGTCTTCACCCCCTTTCTTAGCCCCATCATTTTCAGTCTC
AGGAATAAGGAGCTGAAGAACGCCATACAGAGAAGCTTCCGCAGAACCTTCTGTCCCTTA
AGTTCC


Conceptual translation

MYLFTLLGNLLIMGTIWREHSLHTPMYLFLCALSISEILFTVAVTPRMLVDMLSTHRSIT
FVACASQMFFSFTFGFTHSFLLMIMGYDRYVAICHPLRYNVLMSTRDCARLVSWCWAGGS
VMGMMLTLIIFHLTFCGSNVIHHFLCHVFALLKLACGKETATVSMAVILLCVTALMGCLF
LIFLSYVFIVAAILRIPSAEGRHKTFSTCVSHLTIVVVHYGFASIIYLKPKGAHSMDSNT
LMATTYTVFTPFLSPIIFSLRNKELKNAIQRSFRRTFCPLSS