Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR10K1 Olfactory Receptor

Gene Symbol OR10K1
Organism Cow
Family 10
Subfamily K
Pseudo No
Location chr3:11,435,600-11,436,500 (-)

Sequence information


Nucleotide sequence

ATGGAGTGGGTCAATGAGACCTTGGTGAGAGAGTTTGTCTTCCTTGGCTTCTCATCTCTG
GCTGGGCTGCAGCAGCTACTCTTTGCTGTCTTCTTGGTGGTCTACCTCTTCACCCTGAGC
ACCAATGCCATCATCATCTCCACCATTGTGCTGGACAGAGCCCTCCACACCCCCATGTAC
TTCTTCCTTGCTGTACTCTCCTGTTTTGAGACTTGTTATACCTTCATCATTGTACCTAAG
ATGCTGGTTGATCTGCTGGCCCAGAAGAAGACCATTTCTTTTCTAGGTTGTGCTATCCAG
ATGTTTTCCTTCCTCTTTCTAGGTTGCTCTCACTCTTTCCTGCTGGCAGCCATGGGTTAT
GATCGCTATGTGGCCATCTGTGACCCTTTGCGCTATACAGTGCTCATGGATTATGGGATG
TGTTTGGGACTAGTGGCCGCTGCCTGTGCCTGTGGCTTCACTGTGTCACTGGTCACCACC
TCACTAGTATTTCACCTGCCATTCCACTCCTCCAATCAGCTCCATCACTTCTTCTGTGAT
ATCTCTCCTGTCCTCAAGCTGGCATCTCATTACTCTCGTCTCAGTCAGTTGGTCATATTC
ATGCTTGGTGTATTTGCCTTGATTATTCCCCTGTTACTTATCCTGGTCTCCTACATCCGC
ATCATCTCTGCCATTCTAAAAATCTCATCCTCTGTTGGAAGATACAAGGCCTTCTCTACC
TGTGCCTCCCATCTCATTGTGGTAACTGTTCATTATGGTTGTGCCTCTTTCATCTACTTA
AGGCCCAAATCCAATTACTCTTCAAGTCAAGATGCCCTAATATCTGTGTCTTATACAATC
CTCACTCCATTGTTCAATCCAATGATTTACAGTCTAAGAAATAAGGAATTCAAATCAGCT
CTTCGAAGAGCAATGGTCCAGACTTCATATCCTGTTAAT


Conceptual translation

MEWVNETLVREFVFLGFSSLAGLQQLLFAVFLVVYLFTLSTNAIIISTIVLDRALHTPMY
FFLAVLSCFETCYTFIIVPKMLVDLLAQKKTISFLGCAIQMFSFLFLGCSHSFLLAAMGY
DRYVAICDPLRYTVLMDYGMCLGLVAAACACGFTVSLVTTSLVFHLPFHSSNQLHHFFCD
ISPVLKLASHYSRLSQLVIFMLGVFALIIPLLLILVSYIRIISAILKISSSVGRYKAFST
CASHLIVVTVHYGCASFIYLRPKSNYSSSQDALISVSYTILTPLFNPMIYSLRNKEFKSA
LRRAMVQTSYPVN