Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR11A1 Olfactory Receptor

Gene Symbol OR11A1
Organism Cow
Family 11
Subfamily A
Pseudo No
Location chr23:28,984,400-28,985,400 (+)

Sequence information


Nucleotide sequence

ATGCAAAGAAGCACTAGAATTTGTCACTTAATCACTGCAGAAACTTGGATGACCTTCATG
GAAACGGTCTCCATAGGAAACCAAACGATTACTGAATTTGTCCTTCTTGGTTTCTATGTC
AAAGCTGAGCTGCATCTCCTTCTCTTTATTGTGTTCACTGTCATCTATGCGTCCATCATC
CTAGGGAACATGCTAATCATTGTGGCGGTGGTTAGCTCTCAGAGGCTCCACACACCCATG
TATTTCTTCCTGGCTAATCTGTCCTTCCTGGAGATCCTCTATACTTCCTCAGTGGTGCCC
AAGATGTTGGAGGGCTTCTTGCAGGAGGCGGCCATCTCTGTGGCTGGTTGCTTGCTCCAG
TTCTTTATCTTTGGTTCTTTAGCCACTGCTGAGTGCTTCCTACTGGCTGTCATGGCATAT
GATCGCTACCTGGCCATCTGCTACCCGCTCCGCTACCCTCTCCTGATGGGACCCAGATGG
TGTTTGGGGCTGGTGGTCATAGCGTGGCTCTCTGGCTTCATGGTAGATGGACTGGTTGTA
GCCCTCATGGCCCAACTGAGATTCTGTGGCCGCAACCACATTGACCACTTTTACTGTGAT
TTCATGCCTTTAATGAGCCTGGCCTGCTCAGATCCCAGTGTAGCCCAGATGACAACATTC
ATTCTGTCTGTGGTCTGCCTCACTGTTCCCTTTGGACTGATTCTGACATCTTATGGCCGG
ATCGTGGTGGCTGTGCTGAGAGTTCCTGCTGGGGCCAGCAGAAGGAAGGCTTTCTCTACA
TGTTCCTCCCACCTAGCTGTAGTGTCCACATTCTATGGCTCTCTCATGGTCTTGTACATT
GCGCCCTCTGCTGTCCACTCCCAGCTCCTCACTAAGGTCTTTGCCCTGCTCTACACTGTG
GTCACTCCTGTGTTCAATCCTGTGATTTATACTCTGAGGAATAAGGAAGTTCAACAGGCA
CTATGGAGGCTTCTGTATGTTAAGCAAACTGAAACGATTGAAGGAGGATGGTGG


Conceptual translation

MQRSTRICHLITAETWMTFMETVSIGNQTITEFVLLGFYVKAELHLLLFIVFTVIYASII
LGNMLIIVAVVSSQRLHTPMYFFLANLSFLEILYTSSVVPKMLEGFLQEAAISVAGCLLQ
FFIFGSLATAECFLLAVMAYDRYLAICYPLRYPLLMGPRWCLGLVVIAWLSGFMVDGLVV
ALMAQLRFCGRNHIDHFYCDFMPLMSLACSDPSVAQMTTFILSVVCLTVPFGLILTSYGR
IVVAVLRVPAGASRRKAFSTCSSHLAVVSTFYGSLMVLYIAPSAVHSQLLTKVFALLYTV
VTPVFNPVIYTLRNKEVQQALWRLLYVKQTETIEGGWW