Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR11H12B Olfactory Receptor

Gene Symbol OR11H12B
Organism Cow
Family 11
Subfamily H
Pseudo No
Location chr10:27,178,900-27,179,800 (-)

Sequence information


Nucleotide sequence

ATGTGTCTGTTGATGTTGCAGGTTACTGATCCAGTGAACATGAACATCTCTGAGCCAGAT
TCCCACTTTGTCTTTGTAAGAGAATTTATACTCCTAGGTTTTTCTTATGAGTGGAAGATT
CAGAGCCTCCTCTTCTCACTCTTCCTTACAATATATGCTCTGACCATAACAGGGAATGGG
GCCATTATTTGTGCTTTATGGTGTGACCAGCGACTCCACATCCCCATGTACGTATTCCTG
GGGAATTTCTCCTTCCTAGAGATCTGGTATGTCTCTTCTACATTCCCCGAGATGTTGGTC
AACTTCCTCTCACATAAAAAGACCATCTCCTTTGTTGGATGTTTCCTACAATTTTATTTC
TTTTCTTCCTTGGGAGCAACTGAATGCTTGCATTTGACCGTTATGGCTTTTGATCGGTAC
CTTGCTATCTGCCGTCCCTTGCACTACCCTAATATCATGACTGGGCATCTCTGTACCAAA
CTGGTCCTTATCTGCTGGGTCTGTGGATTTCTGTGGTTCCTGGTCCCCATTGTTCTCATT
TCTCAGATGCCTTTCTGTGGACCAAACATCATTGACCATGTTGTGTGTGACCCAGGGCCA
CTGTTTGCATTGGCATGTGTCTCTGCCCCCAAAACCCAACTGCTTTGCTACAGTCTAAGC
TCAATAGTTATCTTTGGTAACTTCCTCTTCATCCTTGGGTCCTATACTCTTGTCCTAACA
GCTGTGTTGCCTATGCCTTCAGCTACTGGGAGACAGAAAGCCTTCTCCACCTGTGGGTCT
CATTTGGCTGTGGTATCCCTGTTCTATGGCTCTCTCATGGTAATGTATGTGAGCCCAGGA
CTTGGACATTCTGCTAGGATGCAGAAAGTCACAACTTTATTCTATGCTATGGTGACCCCA
TTCTTCAACCCCCTCATTTATAGCCTCCGGAATAAGGAAATAAAGACTGCCCTGAGAAAG
GTTCTGGGGAGTTTCAACATAATG


Conceptual translation

MCLLMLQVTDPVNMNISEPDSHFVFVREFILLGFSYEWKIQSLLFSLFLTIYALTITGNG
AIICALWCDQRLHIPMYVFLGNFSFLEIWYVSSTFPEMLVNFLSHKKTISFVGCFLQFYF
FSSLGATECLHLTVMAFDRYLAICRPLHYPNIMTGHLCTKLVLICWVCGFLWFLVPIVLI
SQMPFCGPNIIDHVVCDPGPLFALACVSAPKTQLLCYSLSSIVIFGNFLFILGSYTLVLT
AVLPMPSATGRQKAFSTCGSHLAVVSLFYGSLMVMYVSPGLGHSARMQKVTTLFYAMVTP
FFNPLIYSLRNKEIKTALRKVLGSFNIM