Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR12D2F Olfactory Receptor

Gene Symbol OR12D2F
Organism Cow
Family 12
Subfamily D
Pseudo No
Location chr23:29,061,800-29,062,800 (-)

Sequence information


Nucleotide sequence

ATGCTGAATCAAACCTCAGTCACTGAATTTCTCCTCCTGGGAGTGACAGACATCCAAGTA
CTGCAGCCTGTTCTCTTCGTGATTTTCCTTGCAACTTACATTGTCAATGTGGCTGGGAAT
GCAGCCATCCTGATGGTTGTCATCTCTGATCCAAGACTCCATTCTCCTATGTATTTTTTT
CTGGGAAACCTGTCATGTCTAGATATCTGCTACTCCACGGTGACTCTGCCAAAGATGCTG
GAGAACTTCCTCTCTATACACAAAGCAATTTCTTTCTTGGGATGCATAAGCCAGCTTCAT
TTCTTCCACTTCCTAGGCAGCACAGAGGTCATGTTGCTGGCCGTGATGGGTTTTGACCGC
TTTGTGGCTATCTGCAAACCACTTCATTACACTGTTATCATGAATCATCAGGTCTGTACC
CAGATGGCTGTCACTGTCTGGATCATTGGTTTTTTCCATGCCCTACTGCACTCAGTAATG
ACATCTCGTTTAAACTTCTGTGGTTCCAACCACATCCATCATTTCTTCTGTGATGTTAAG
CCATTGCTGGAGTTGGCCTGTGGGAACACTGACCTCAATGAGTGGCTACTTCATACTGTC
ACAGAGACCATTGCCATGGGCTCATTCTTTCTAATTCTTCTCTCCTATTTCTATATTATT
ATCTATCTTTTCTTCAAGACTCATTCTTGCAGAATGCTTCGTAAAACACTGTCTACTTGT
GCCTCCCACTTCATGTTGGTTGTTCTTTTATTTGGCCCTGTTTTTTTCATTTACATTCGT
CCTGCCTCGGGTAGCTCCATGGACCATGACCGGACTGTTGCCATTATGTACAGTGTGGTC
ACTCCTGTGCTAAATCCACTGATCTATACTCTGAGGAACAAGGAAGTAAAGGGGGCCTTG
AAGAGGGTGATCAGAAGAAGGCCC


Conceptual translation

MLNQTSVTEFLLLGVTDIQVLQPVLFVIFLATYIVNVAGNAAILMVVISDPRLHSPMYFF
LGNLSCLDICYSTVTLPKMLENFLSIHKAISFLGCISQLHFFHFLGSTEVMLLAVMGFDR
FVAICKPLHYTVIMNHQVCTQMAVTVWIIGFFHALLHSVMTSRLNFCGSNHIHHFFCDVK
PLLELACGNTDLNEWLLHTVTETIAMGSFFLILLSYFYIIIYLFFKTHSCRMLRKTLSTC
ASHFMLVVLLFGPVFFIYIRPASGSSMDHDRTVAIMYSVVTPVLNPLIYTLRNKEVKGAL
KRVIRRRP