Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR13C8 Olfactory Receptor

Gene Symbol OR13C8
Organism Cow
Family 13
Subfamily C
Pseudo No
Location chr8:96,092,400-96,093,300 (+)

Sequence information


Nucleotide sequence

ATGGGAAGAACCAATGATTCCGTGTTGAGAGAATTTGTTCTGACTGGGCTTTCTGCTCAC
CCAGAGCTCCAGACAGTATTCTTTGTGCTAGTTCTGTGTATGTACCTGATGATCCTGCTG
GGAAATGGAGTCCTTATCTCTGTAATCATCTGTTATTCTCATTTGCACACCCCCATGTAT
TTCTTCCTCTGTAATCTTTCCTTCCTGGACATTTGCTATACAAGCTCCTCTGTCCCATTA
ATTCTTGACAGTTTTCTTACAGTAAGGAAAAGGGTTTCCTTCTCTGGATGCATGGTGCAA
ATGTTTCTCTCTTTTGCCATGGGAGCCACAGAGTGTGTCCTTCTGGGCATGATGGCACTT
GACCGCTATGTGGCCATCTGCTACCCACTGAGATACCCTGTCATCATGAGAAAAGGTGCT
TACGTGCCCATGGCAGCTGGATCCTGGGTTGCAGGTATTGTTGACTCAGTGGTGCAGACA
TCTCTTGCATTGCAATTACCATTTTGTGCTGACAATGTAATTAACCATTTTGTTTGTGAA
ATTCTGGCTATCCTAAAATTGGCCTGTGCTGATATTTCAATTAATGTGATCAGCATGGCA
GGGTCAAATCTGATTGTTCTAGTTATTCCATTGCTAGTAATTTCCATCTCTTACATTTTC
ATTGTTGCCACTATTCTAAGAATACCTTCCACTGAAGGAAAACGTAAGGCCTTCTCCACC
TGCTCAGCCCATCTCACAGTAGTGATTGTATTCTTTGTAACAATCTTCTTCATGTATGCT
AAGCCCAAATCTAAAAGCTCCGCTGGTACAGATAATCAAGACATCATTGAGGCCCTCATC
TCTCTCCTCTATGGAGTGATGACTCCCATGCTCAATCCTCTCATCTATAGTCTGAGGAAC
AAGGATGTAAAAATTGCTGTGAGGAACATGCTGGGTAGGAAAAACTTCTCTGATGGAATA


Conceptual translation

MGRTNDSVLREFVLTGLSAHPELQTVFFVLVLCMYLMILLGNGVLISVIICYSHLHTPMY
FFLCNLSFLDICYTSSSVPLILDSFLTVRKRVSFSGCMVQMFLSFAMGATECVLLGMMAL
DRYVAICYPLRYPVIMRKGAYVPMAAGSWVAGIVDSVVQTSLALQLPFCADNVINHFVCE
ILAILKLACADISINVISMAGSNLIVLVIPLLVISISYIFIVATILRIPSTEGKRKAFST
CSAHLTVVIVFFVTIFFMYAKPKSKSSAGTDNQDIIEALISLLYGVMTPMLNPLIYSLRN
KDVKIAVRNMLGRKNFSDGI