Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR1A1 Olfactory Receptor

Gene Symbol OR1A1
Organism Cow
Family 1
Subfamily A
Pseudo No
Location chr19:24,520,600-24,521,500 (-)

Sequence information


Nucleotide sequence

ATGAGAGAAGACAACCAATCTTCTACCTTCAATTTCATCCTCCTGGGAGTTACTGGCCAG
CAAAAACAGGAAGACTTCTTCTTCTTACTTTTCCTGTTCATTTACCCCACCACATTGATT
GGAAACCTGCTCATCATCTTGGCCATTTGCTCTGACATTCGCCTCCACAACCCCATGTAT
TTTCTCCTTGCCAACCTCTCCTTTGTTGACATCTTCTTCTCCTCTGTAACTATCCCTAAG
ATGCTGGCCAACCACCTCCTGGGCAGCAAAGCCATCTCCTTTGGAGGATGCCTAACACAA
ATGTATTTTATGATTGCCTTGGGTAACACAGATAGTTACATCCTGGCTGCTATGGCCTAT
GATCGAGCTGTGGCCATCACCCGCCCACTTCACTACACAACAATCATGAGCCCATGGACT
TGTGTCCTGCTAGTCATTGGGTCTTGGGTGGTTGGAAATGGCAATGCCCTCCCCCACACT
CTGCTCACAGCTAGCCTGTCCTTCTGTGGAAACCAGGAAGTGGCCAACTTCTACTGTGAC
ATTACCCCTTTGCTCAAGCTGTCCTGTTCTGACATCCACTTTAATGTGAAGATGATGTAC
CTGGGGGTTGGTGTTTTCTCCGTGCCATTACTATGCATCATCATCTCTTATGTTCGGGTC
TTTTCCACAGTCTTACGGGTTCCATCCACCAAAGGTGTGCTCAAAGCCTTCTCCACCTGT
GGCTCCCACCTCACCGTTGTTTCTCTGTATTATGGGACAGTCATGGGCATGTACTTCCGC
CCTCTGACTAGTTATAACCTAAAGGATGCAGTGATAACTGTGATGTACATAGCAGTGACC
CCAATGTTAAATCCTTTCATCTACAGTCTGAGGAATCGGGACATGAAGGCTGCCCTGGGG
AAACTCTTCAGCAGGAGAATTTTTTCACAACCAATG


Conceptual translation

MREDNQSSTFNFILLGVTGQQKQEDFFFLLFLFIYPTTLIGNLLIILAICSDIRLHNPMY
FLLANLSFVDIFFSSVTIPKMLANHLLGSKAISFGGCLTQMYFMIALGNTDSYILAAMAY
DRAVAITRPLHYTTIMSPWTCVLLVIGSWVVGNGNALPHTLLTASLSFCGNQEVANFYCD
ITPLLKLSCSDIHFNVKMMYLGVGVFSVPLLCIIISYVRVFSTVLRVPSTKGVLKAFSTC
GSHLTVVSLYYGTVMGMYFRPLTSYNLKDAVITVMYIAVTPMLNPFIYSLRNRDMKAALG
KLFSRRIFSQPM