Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR1D3 Olfactory Receptor

Gene Symbol OR1D3
Organism Cow
Family 1
Subfamily D
Pseudo No
Location chr19:24,480,800-24,481,700 (-)

Sequence information


Nucleotide sequence

ATGGATGGAAGCAACCATAGTAGAGTCTCTGAGTTCCTGCTCCTTGGGCTGTCGGAGAGT
CCTGAGCATCAGAGGGTCCTGTTTTGGATGTTCCTGTCCATGTACCTGGTCACAGTGGTG
GGAAATGTGCTCATCATCTTGGCCATTGGCTCTGACTCCCGCCTGCACACTCCCATGTAC
TTCTTCCTGGCCAACCTCTCCTTCACTGACCTCTTCTTCGTCACCAACACAATCCCCAAG
ATGCTGGTGAACCTTCAGTCCCAGAACAAAGCCATCTCATATGCAGGGTGTCTGACCCAG
CTCTACTTCCTGGTCTCCTTGGTGGCTCTGGACAACCTCATCCTGGCCACGATGGCATAT
GACCGCTATGTGGCCATCTGCCGCCCACTCCACTACACCACGGCCATGAGCCCTAGGCTC
TGTATTTCACTCCTTACCCTGTGCTGGGCACTCTCTGTCCTCTACGGCCTCATTCACACC
CTCCTCATGACCAGTGTGACCTTCTGTGGGTCCCGGAAGATTCACTATATCTTTTGTGAG
ATGTATGTCTTATTGAGACTCGCATGTTCCAACACCCAGATCAATCACGCAGTGCTGATT
GCCACAGGATCCTTTATCTTCCTCACCCCCTTTGGGTTCATGGTCATGTCCTATGTCTGG
ATTGTCAGAGCCATCTTCCAAATACCCTCAGCCTCTAGCAAGTACAAAGCCTTCTCCACC
TGTGCCTCCCATTTGGCTGTGGTTTCCCTCTTCTATGGGACCCTTTGTATGGTATATCTG
AAGCCTCTCGACACCTACTCCATGCAGGACTCAGTAGCCACAGTGATGTACGCTATGGTA
ACCCCCATGATGAACCCTTTCATCTACAGCCTGAGGAACAAGGACATACACGGAGCTCTG
GGAAGATTTTTCTTAGGAAAGTCTTTCAGAGGT


Conceptual translation

MDGSNHSRVSEFLLLGLSESPEHQRVLFWMFLSMYLVTVVGNVLIILAIGSDSRLHTPMY
FFLANLSFTDLFFVTNTIPKMLVNLQSQNKAISYAGCLTQLYFLVSLVALDNLILATMAY
DRYVAICRPLHYTTAMSPRLCISLLTLCWALSVLYGLIHTLLMTSVTFCGSRKIHYIFCE
MYVLLRLACSNTQINHAVLIATGSFIFLTPFGFMVMSYVWIVRAIFQIPSASSKYKAFST
CASHLAVVSLFYGTLCMVYLKPLDTYSMQDSVATVMYAMVTPMMNPFIYSLRNKDIHGAL
GRFFLGKSFRG