Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR1F1 Olfactory Receptor

Gene Symbol OR1F1
Organism Cow
Family 1
Subfamily F
Pseudo No
Location chr25:2,646,520-2,647,470 (+)

Sequence information


Nucleotide sequence

ATGGGAGAGGCGAACCAGTCGAGAGTCTCTGAGTTCCTCCTCCTGGGGCTCTCCAGGCAG
CCCCAGCAGCAGCAGCTCCTCTTCCTGCTCTTCCTGACCATGTACCTGGCCACAGTCCTG
GGAAACCTGCTCATCCTCCTAGCCATCAGCATGGACTCTCGCCTGCACATCCCCATGTAC
TTCTTCCTCTGCAACCTGTCTTTCGTGGACATCTGCTTCTCCTCCACCACTGTCCCCAAA
GTGCTGGCCAACCACATACTCGGGAGACAGACCATCTCTTTCTCTGGGTGTCTCACGCAG
ATGTACTTTGTTTTCATGTTCGTGGACATGGACAATTTCCTCCTGGCTGTGATGGCCTAT
GACCGCTTTGTGGCTGTATGCCACCCCTTACACTATTCAGCGAAGATGACCCCCCAGCTC
TGTGTCCTGCTGGTCACTGGGTCGTGGATCATTGCCAACTTGAATGTCCTGTTGCACACC
CTGCTGATGGCTCGACTCTCCTTCTGTGCAGACAATGCCATCCCCCACTTCTTCTGTGAT
GTGACCCCCCTCCTCAAACTCTCCTGCTCTGACACACACCTCAATGAGGTGGTGATTCTG
ACTGAGGGTGCCCTGATCATGATCACCCCGTTCGTTTGCATCCTGGCTTCATATGTCCGC
ATCACCTGTGCTGTCCTGAGGATCCCATCCACAAAGGGGAGATGGAAAGCCTTCTCCACC
TGTGGCTCCCACCTGGCTGTGGTTTCCCTCTTCTATGGCACCATCATTGCTGTGTATTTC
AACCCTTTGTCCTCCCACTCGTCGGAGAAGGACACTGTAGCTACTGTGATGTACACGGTG
GTGACCCCCACGCTGAATCCTTTCATCTACAGCCTGAGGAACAGAAACTTGAAAAGGGCT
CTTGGAAAAGTGGTTGGCAGGAAAATGTTTTCTGTCTCAGGAGAGAATCAAAAC


Conceptual translation

MGEANQSRVSEFLLLGLSRQPQQQQLLFLLFLTMYLATVLGNLLILLAISMDSRLHIPMY
FFLCNLSFVDICFSSTTVPKVLANHILGRQTISFSGCLTQMYFVFMFVDMDNFLLAVMAY
DRFVAVCHPLHYSAKMTPQLCVLLVTGSWIIANLNVLLHTLLMARLSFCADNAIPHFFCD
VTPLLKLSCSDTHLNEVVILTEGALIMITPFVCILASYVRITCAVLRIPSTKGRWKAFST
CGSHLAVVSLFYGTIIAVYFNPLSSHSSEKDTVATVMYTVVTPTLNPFIYSLRNRNLKRA
LGKVVGRKMFSVSGENQN