Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR1F1C Olfactory Receptor

Gene Symbol OR1F1C
Organism Cow
Family 1
Subfamily F
Pseudo No
Location chr25:2,651,860-2,652,710 (+)

Sequence information


Nucleotide sequence

ATGTACCTGGCCACCGTTCTGGGAAACCTGCTCATCCTCCTAGCCATCAGCGTGGACTCC
CGCCTGCACATCCCCATGTACTTCTTCCTCTGCAACCTGTCTTTTGTGGACATCTGCTTC
TCCTCCACCACTGTCCCCAAAGTGCTGGCCAACCACATACTCGGGAGACAGACCATTTCC
TTCTCTGGCTGCCTCATGCAGATGTATTTTCTCTTTGAGTTTGCTGACATGGACAATTTC
CTCCTGGCTGTGATGGCCTATGACCGCTTTGTGGCTGTATGCCACCCCTTACACTATTCA
GCAAAGATGACCCCCCAGCTCTGTGCCCTGCTGGTCACTGGATCGTGGGTCACTGCCAGC
TTGAATGCTCTGTTGCACACCCTACTGATGGCACGACTCTCCTTCTGTGCAGACAATGCC
ATCCCCCACTTCTTCTGTGATGTGACCCCCCTCCTCAAACTCTCCTGCTCTGACACACAC
CTCAGTGAGGTGATGATTCTGACTGAGGGTGCCCTGATCATGATCACCCCGTTCGTTTGC
ATCCTGGCTTCATATGTCCGCATCACCTGTGCTGTCCTGAGGATCCCATCCACAAAGGGG
AGATGGAAAGCCTTCTCTACCTGTGGCTCCCACCTGGCTATGGTTTCCCTCTTCTATGGC
ACCATCATTGCTGTGTATTTCAACCCTTTGTCCTCCCACTCGTCGGAGAAGGACACTGTA
GCTACTGTGATGTACACGGTGGTGACCTCCATGCTGAATCCTTTCATCTACAGCCTGAGG
AACAGAGACTTGAAAAGGGCTCTTGGAAAAGTGGTTGGCAGGAAAATGTTTTCTGTCTCA
GGAGACAATCAAAAC


Conceptual translation

MYLATVLGNLLILLAISVDSRLHIPMYFFLCNLSFVDICFSSTTVPKVLANHILGRQTIS
FSGCLMQMYFLFEFADMDNFLLAVMAYDRFVAVCHPLHYSAKMTPQLCALLVTGSWVTAS
LNALLHTLLMARLSFCADNAIPHFFCDVTPLLKLSCSDTHLSEVMILTEGALIMITPFVC
ILASYVRITCAVLRIPSTKGRWKAFSTCGSHLAMVSLFYGTIIAVYFNPLSSHSSEKDTV
ATVMYTVVTSMLNPFIYSLRNRDLKRALGKVVGRKMFSVSGDNQN