Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR1J4D Olfactory Receptor

Gene Symbol OR1J4D
Organism Cow
Family 1
Subfamily J
Pseudo No
Location chr11:93,691,900-93,692,800 (-)

Sequence information


Nucleotide sequence

ATGACGAAGGAGAACCAGAGCAGCATGTCTGAATTCCTCCTCCTGGGGCTCTCCATCCGG
CCAGAGCAGCAGGGTGTGTTCTTCGCCCTGTTCCTGGGCATGTACCTCACCACGGTGCTG
GGCAACCTGCTCATCCTCCTGCTCATCAGGCTGGACTCTCATCTCCACTCCCCCATGTAC
TTCTTCCTCAGCCACTTGGCCCTCACTGACGTCTCCTTTTCATCTGTCACTGTCCCTAAG
ATGCTGATAAACATGCATACTCGGGATCAATCCATCCCCTATGCAGGATGTGTAACACAG
ATGTATTTTTTCATATTTTTTACTGATCTGGACAATTTCCTGCTCAGTTCAATGGCCTAT
GATCGGTACGTGGCCATCTGCCACCCTCTCCACTACGGCACCGTCATGAGACAGGGGCTG
TGCACCTTACTAGTAACTGCATCCTGGATTCTCTCCTGTGCCAGTGCCCTGTGTCACACC
CTCCTCCTGACCCGGCTGTCCTTTTGTGCTGACCTCAGCATCCCCCATTTCTTCTGTGAT
CTTGGTAGCCTGCTGAAGCTCTCCTGCTCAGACACATCCCTTAATGAGCTGGCCATATTC
ACAGCAGGAGTGGCTGTCATCGTCCTCCCATTAATATGCATCCTGATCTCTTATGGATGC
ATCAGTGCCGCCATCCTGAAGGTCCCCTCCACCAGGGGGATCTGCAAAGCATTGTCTACC
TGTGGCTCTCACCTCTCTGTGGTGTCTCTGTATTATGGAACAATTATTGGGCTGTATTTT
TTCCCCTCATCCAACACGTCCAGGGACAAGAGCACCATTGCCTCTGTGATGTACACAGTG
GTCACTCCACTGCTGAACCCCTTCATTTATAGCCTAAGGAACAGGGACATGAAGGGGGCC
CTGGAGAGACTCTTGCACGGGGCAAAAGTCTTGTCTCAA


Conceptual translation

MTKENQSSMSEFLLLGLSIRPEQQGVFFALFLGMYLTTVLGNLLILLLIRLDSHLHSPMY
FFLSHLALTDVSFSSVTVPKMLINMHTRDQSIPYAGCVTQMYFFIFFTDLDNFLLSSMAY
DRYVAICHPLHYGTVMRQGLCTLLVTASWILSCASALCHTLLLTRLSFCADLSIPHFFCD
LGSLLKLSCSDTSLNELAIFTAGVAVIVLPLICILISYGCISAAILKVPSTRGICKALST
CGSHLSVVSLYYGTIIGLYFFPSSNTSRDKSTIASVMYTVVTPLLNPFIYSLRNRDMKGA
LERLLHGAKVLSQ