Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR1S7 Olfactory Receptor

Gene Symbol OR1S7
Organism Cow
Family 1
Subfamily S
Pseudo No
Location chr15:82,916,400-82,917,300 (+)

Sequence information


Nucleotide sequence

ATGCATCTAGGAAACCAAACGAGTGTCTCTGAATTCCTCCTCCTGGGACTCTCCACCCAA
CCTGAGCAGCAGGAGCTCCTCTTTGCGCTTTTCCTGGCTATGTACCTGGCCACTGTGGTG
GGGAACGGGCTCATCATTCTGGCCATCGGCTTGGACTCTTACCTTCACACCCCCATGTAC
CTCTTCCTCGCCAACCTAGCCTTTGCTGATATTTCCTCCATTTCCACCTCAGTCCCCAAA
ATGCTGATGAATATTCAGACCAAGAGTCCATCCATCTCCTATGAGAGCTGCGTCACACAG
ATGTATTTTTCTATTGTCTTTGTTGTCATTGACAACTTCCTCTTGGGGGTCATGGCCTGT
GACCGCTTTGTGGCTATCTGCCACCCTCTGAACTACACGGCCATCATGGGACCCAGGCTC
TGCCTTTGGCTGACCGCCATCCCCTGGGTCCTCAGTAATGCTGTCGCCCTGACACACACC
CTTCTGCTCCTTCGACTGGTCTTCTGTGATGGCAATGCTCTCCCGCACTTCTTCTGTGAC
CTGGCCCCGCTGCTCAGGCTGTCCTGCTCAGACACGACGGCCAATGAGCTCGTGCTCTTT
GTCGTGGGCTCGTGGGTTGTCACCCTGCCCTTCGCCCTCACCCTCATCTCCTATGTCTGC
GTCGTCAGGGCTGTCCTGAGACTCTCACCCACAGAGGGGCAGTGGAAAGCCTTCTCCACC
TGTGGCTCTCACCTGACAGTCGTGTTCCTCTTCTACGGGACCATCGCAGGGGTCTACTTC
TTCCCTTCATCCTCTGACCCTGACAACAGAGACAAGATTGGGGCGGTGCTGTTCACTGTG
GTGACCCCCATGATGAACCCCTTCATCTACAGCCTGAGGAACAAGGACATGAAAGGGGCC
CTGAGGAGACTCCTCCATGGGAGAAGGGCTCTCCCTGTGATGCCC


Conceptual translation

MHLGNQTSVSEFLLLGLSTQPEQQELLFALFLAMYLATVVGNGLIILAIGLDSYLHTPMY
LFLANLAFADISSISTSVPKMLMNIQTKSPSISYESCVTQMYFSIVFVVIDNFLLGVMAC
DRFVAICHPLNYTAIMGPRLCLWLTAIPWVLSNAVALTHTLLLLRLVFCDGNALPHFFCD
LAPLLRLSCSDTTANELVLFVVGSWVVTLPFALTLISYVCVVRAVLRLSPTEGQWKAFST
CGSHLTVVFLFYGTIAGVYFFPSSSDPDNRDKIGAVLFTVVTPMMNPFIYSLRNKDMKGA
LRRLLHGRRALPVMP