Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR2F2B Olfactory Receptor

Gene Symbol OR2F2B
Organism Cow
Family 2
Subfamily F
Pseudo No
Location chr4:107,937,000-107,938,000 (+)

Sequence information


Nucleotide sequence

ATGGGAGCAAATAACCAGACTTGGGTGAGAGAATTCATTCTCCTCGGCCTGTCCAATGAC
TGGGACACTCAGGTCACTCTCTTCGTCTTGTTCTCAGTCACTTACCTGCTGACCCTGCTG
GGGAACGTCCTCATTGTTCTTCTGATCAGACTGGACAGCCGACTCCACACTCCCATGTAT
TTCTTTCTCACCAACCTCTCCCTTGTTGATGTCTCCTATGCCACAAGCATCGTTCCTCAG
ATGCTGGTGCATTTTCTTGCGGAGCATAAAGGGATCCCCTATGTCAGCTGTGCAGCCCAG
TTATTCTTCTCCCTGGGCCTGGGTGGGATTGAGTTTGTTCTCCTGGCCATGATGGCCTAT
GACCGCTATGTGGCTGTGTGCGACCCCCTGAGATACTCGGTCATCATGCACGGAGGGCTC
TGTGCTAGGCTGGCCATCACATCCTGGGTCAGTGGCTCTGTCAACTCTCTCGTGCAGACC
ACCATCACCTTTCAGTTGCCTATGTGCACGAACAAGTATATTGATCACATATCCTGTGAA
ATCCTAGCTGTGGTCAGGCTGGCCTGTGTGGACACCTCCTCCAATGAGGTGGCCATCATG
GTTTCTAGTATTGTGTTGCTGATGACACCTTTCTGCCTGGTTCTCCTGTCCTACATCAGG
ATCATCTCCACCATCCTGAAGATCCAGTCCACAGAGGGGAGAAAGAAAGCCTTCCACACC
TGTGCCTCTCACCTCACAGTGGTTTTCTTGTGCTATGGCATGACCATTTTCACTTACATC
CAGCCCAATTCCAGCCCTTCTGTGCTTCAGGAGAAGCTGATCTCTGTCTTCTATGCCATT
TTGATGCCTGTGCTGAACCCCATGATTTACAGTCTAAGGAACAAGGAGGTGAAGGGGGCC
TGGCAGAAGCTTCTAGGACAATTATCTGGATTAATGTCAAAATTGGGAACT


Conceptual translation

MGANNQTWVREFILLGLSNDWDTQVTLFVLFSVTYLLTLLGNVLIVLLIRLDSRLHTPMY
FFLTNLSLVDVSYATSIVPQMLVHFLAEHKGIPYVSCAAQLFFSLGLGGIEFVLLAMMAY
DRYVAVCDPLRYSVIMHGGLCARLAITSWVSGSVNSLVQTTITFQLPMCTNKYIDHISCE
ILAVVRLACVDTSSNEVAIMVSSIVLLMTPFCLVLLSYIRIISTILKIQSTEGRKKAFHT
CASHLTVVFLCYGMTIFTYIQPNSSPSVLQEKLISVFYAILMPVLNPMIYSLRNKEVKGA
WQKLLGQLSGLMSKLGT