Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR2H1 Olfactory Receptor

Gene Symbol OR2H1
Organism Cow
Family 2
Subfamily H
Pseudo No
Location chr23:28,903,000-28,903,900 (-)

Sequence information


Nucleotide sequence

ATGGTCAACCACAGCTTCCCAGTGGACTTCCTCCTTCTGGGCTTCTCTGAACACCCAGGG
CTTGAAAGAATCCTCTTCATGGTTGTCTCAATCTCTTACCTCCTGACTCTGGTGGGCAAC
ACACTCATCATCCTGCTGTCCATGCTGGACCCCAGGCTCCACTCCCCGATGTACTTTTTC
CTCTCCAACCTCTCCTTCCTGGACCTCTGCTTCACCACAAGCTGTGTCCCGCAGATGCTG
GTCCACCTCTGGGGCCCAAGGAAGACCATCAGCTTCCTTGGCTGCTCTGTCCAGCTCTTC
ATCTTCCTGTTCCTGGGGACCACGGAGTGTGTCCTCCTGACCGTGATGGCCTTTGACCGC
TACGTGGCTGTCTGCCAGCCCCTCCACTATGCCACCATCATCCACCCCCGCCTGTGCTGG
CAGCTGGCGGCCGTGGCCTGGGTAATGGGTCTGGTCCAATCGGTAGTCCAGACACCACCG
ACCCTCCGCCTGCCCTTCTGCCCACATCGGCAGATAGATGACTTTGCGTGTGAGGTCCCT
TCTCTAATTCAACTGTCCTGTGGAGACACCACCTACAATGAAATCCAGTTAGCTGTGTCC
AGTTTCATCTTCCTGGTCATGCCACTTACCCTCATCCTTATCTCTTACGGTTCCATTGCC
TGGGCAGTGCTGAGGATTAACTCGGCCATAGCATGGAGGAAGGCTCTGGGGACCTGCTCT
TCCCATCTCATTGTGATCACCTTATTCTACAGTTTAGTCATTGCTGTCTACCTCCAGCCC
AAAAATCCTTATGCCCAGAAGAGAGGCAAGTTCTTTGGTCTCTTCTATGCAGTGGGCACT
CCTTTACTTAATCCCCTCATATACAGCCTGAGGAACAAGGAGGTAAAGGGGGCGCTCAGG
AGGTTGCTGGGGAAAGACAAGGACTCCAGGGAGAAC


Conceptual translation

MVNHSFPVDFLLLGFSEHPGLERILFMVVSISYLLTLVGNTLIILLSMLDPRLHSPMYFF
LSNLSFLDLCFTTSCVPQMLVHLWGPRKTISFLGCSVQLFIFLFLGTTECVLLTVMAFDR
YVAVCQPLHYATIIHPRLCWQLAAVAWVMGLVQSVVQTPPTLRLPFCPHRQIDDFACEVP
SLIQLSCGDTTYNEIQLAVSSFIFLVMPLTLILISYGSIAWAVLRINSAIAWRKALGTCS
SHLIVITLFYSLVIAVYLQPKNPYAQKRGKFFGLFYAVGTPLLNPLIYSLRNKEVKGALR
RLLGKDKDSREN