Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR2K2 Olfactory Receptor

Gene Symbol OR2K2
Organism Cow
Family 2
Subfamily K
Pseudo No
Location chr8:102489023-102489970 (-)
Aliases LOC539574, ENSBTAG00000010686

Sequence information


Nucleotide sequence

ATGCAAGGCGAAAATCTCACCAGCTGGAGTTTCTTTTTCCTGGAAGGTTTTTCTAGATAC
CCAAAGTTGGAGATTGTTCTCTTCATCTTCAGCCTTTTCGTGTATCTGATAACCCTCTTG
GGCAACAGCATTCTTATTTTGATCACTGTCGTAGACTCACGCCTTCAGACTCCCATGTAC
TTGTTCCTTGGAAATCTCTCTTTCATGGATATTTGTTACACATCTGCTTCGATTCCTACT
TTGCTGGTGAACTTGCTGTCATCCCAGAAAACCATCGTCTTTTCTGGGTGTGCTGTACAG
ATGTATCTGTCCCTTGCCATGGGCTCCACGGAGTGTGTGCTCCTGGCTGTGATGGCGTAT
GACCGTTATGTGGCCATTTGCAGCCCGCTGAGATACCCCGTCATCATGAACAGACAGGTC
TGTGTGCAGATGGCCACCATCTCCTGGGTGACGGGCTCTCTGACAGCCCTGCTGGAAACC
AGCTTCGCCCTACGGATACCCCGCTGTGGGAATCTCATTGACCACTTCACGTGTGAAATT
CTGGCAGTGCTGAAGCTAGCTTGCACACGGTCTCTGCTCATGGACACAGTCATGCTGGTG
ATCAGTGTGCTCCTCCTGCCCATTCCAATGCTCTTAATTTGCATCTCTTATGTCTTCATC
CTTTCCACTATTCTGAGAATCAGCTCAGCAGAGGGCAGAAACAAAGCTTTTTCTACTTGT
GGTGCCCACTTGACTGTGGTCATCTTGTATTACGGGGCTGCCCTCTCCATGTACCTAAAG
CCTTCTTCATCAGGCTCACAAGAAATAGATAAAATCATCTCGTTGCTTTATGGAGTGCTT
ACGCCTATGCTGAATCCCATAATTTACAGTTTAAGAAACAAAGAAGTCAAAGATGCGGTG
AAAAAAGTGCTGGGCAAAATGTACTTACAACAAACACAGGAACATCTC


Conceptual translation

MQGENLTSWSFFFLEGFSRYPKLEIVLFIFSLFVYLITLLGNSILILITVVDSRLQTPMY
LFLGNLSFMDICYTSASIPTLLVNLLSSQKTIVFSGCAVQMYLSLAMGSTECVLLAVMAY
DRYVAICSPLRYPVIMNRQVCVQMATISWVTGSLTALLETSFALRIPRCGNLIDHFTCEI
LAVLKLACTRSLLMDTVMLVISVLLLPIPMLLICISYVFILSTILRISSAEGRNKAFSTC
GAHLTVVILYYGAALSMYLKPSSSGSQEIDKIISLLYGVLTPMLNPIIYSLRNKEVKDAV
KKVLGKMYLQQTQEHL