Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR2L2 Olfactory Receptor

Gene Symbol OR2L2
Organism Cow
Family 2
Subfamily L
Pseudo No
Location chr7:42,947,500-42,948,400 (-)

Sequence information


Nucleotide sequence

ATGGAAAATTATAATCAAACATCAACTTATTTCACTTTATTGGGATTGTTCCCATCTTCA
AGAATTGGCCTATTTCTTTTTATTCTCATTGTTCTCATTTTTCTAATGGCTCTATTTGGT
AACCTCTCCATGTTCCTTGTCATCTTTCTCGACACCCATCTTCAGAAACCCATGTATTTT
CTACTCAGTCAGCTCTCCCTCGTGGACCTGACCTACATTTCCAACATTGTACCCAAAATG
GCCTATGATTTTCTATTTGGAAACAAGTCTATCTCCTTCATTGCATGTGGGATACAGAGC
TTCTTTTTCTTGACTTTAGCAGGTGCAGAAGGATTGCTCTTGGCTTCTATGGCTTATGAT
CGTTATGTGGCCATTTGCTTTCCTCTCCACTATCCCATCAAAATCAGTAGAAGAGTATGT
GTGCTTATGATAATAGGATCTTGGCTCCTGGGCTCAATCAACTCCTGTGCCCACACCATA
TATGCCCTCCATATCCCTTATTGCCGATCCAAGGCCATCAATCATTTCTTCTGTGATGTT
CCAGCCATGTTGACTTTGGCCTGCATGGACACCTGGGTCTATGAGTACACAGTATTTGTG
AGCACCACCATCTTTCTTTTGTTGCCTTTCACTTGTATTGTATTTTCTTATGGCCGTGTT
CTCCTTGCTGTGTATCGAATGCACTCAGCAGAAGGGAAGAAGAAGGCCTATTCAACATGT
AGCACCCATCTCACTGTGGTAACTTTCTACTCTGCACCATTGCTTACACTTATCTCCGTC
CAAAATCTCTGCGTAGTCCAACAGAGGACAAGGTTCTTGCTGTCTTCTACACCATCCTTA
CCCCAACGCTCAACCCTGTTATCTATAGCA


Conceptual translation

MENYNQTSTYFTLLGLFPSSRIGLFLFILIVLIFLMALFGNLSMFLVIFLDTHLQKPMYF
LLSQLSLVDLTYISNIVPKMAYDFLFGNKSISFIACGIQSFFFLTLAGAEGLLLASMAYD
RYVAICFPLHYPIKISRRVCVLMIIGSWLLGSINSCAHTIYALHIPYCRSKAINHFFCDV
PAMLTLACMDTWVYEYTVFVSTTIFLLLPFTCIVFSYGRVLLAVYRMHSAEGKKKAYSTC
STHLTVVTFYSAPLLTLISVQNLCVVQQRTRFLLSSTPSLPQRSTLLSIA