Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR2T1 Olfactory Receptor

Gene Symbol OR2T1
Organism Cow
Family 2
Subfamily T
Pseudo No
Location chr7:43,401,900-43,403,000 (+)

Sequence information


Nucleotide sequence

ATGAAGAAAAATATGTTAAATGTTTTCTTCCAACTTTTAGAAATCTACTTCTTAACAATC
AATCTGTATACTGTGTTAATTCCTTGTAAACATCATGGTTTTATTTTAAAGATTCTAGGT
CACACGAGTGCCCTCATGGGATCAATGGAAGAGTACAACACATCCTCTACAGACTTTACT
TTCATGGGGTTGTTTAATAGAAAGGAAACATCAGGCCTGCTTTTTGCCATCATCTCTATT
ATCTTTTTTACTGCATTGATGGCCAATGGGGTCATGATATTTCTGATCCGCACTGATTCG
CACCTCCACACCCCCATGTACTTCCTACTTAGCCACCTCTCCTTCATTGACATGATGTAC
ATTTCTACCATTGTGCCCAAGATGTTGGTAGATTACCTGCTGGATCAAAGGACCATCACC
TTTGTGGGATGCACAGCTCAACACTTCCTCTACCTCACCCTTGTGGGAGCTGAGTTCTTC
CTGTTGGGTCTCATGGCCTATGACCGCTACGTGGCCATCTGTAACCCGCTCCGCTATCCA
ATCCTAATGAGCCGCCGTGTTTGCTGGATGATTATAGCAGGTTCCTGGTTTGGGGGCTCT
TTAGATGGCTTTCTTCTAACTCCCATAACCATGAGTTTCCCCTTCTGCAACTCTCGGGAG
ATTAACCATTTCTTCTGTGAGGCACCTGCAGTCCTGAAATTGGCTTGTGCAGACACAGCT
CTCTATGAGACAGTGATGTATGTGTGTTGTGTCTTGATGTTACTGATTCCTTTCTCTGTG
GTGATTGCCTCCTATGCTCAAATCCTGACCACAGTCCACCGCATGAGCTCAGTGGAAGGG
AGAAAGAAGGCATTTGCCACCTGTTCATCTCACATGACAGTGGTGACCTTGTTCTATGGG
GCTGCCATGTACACTTACATGCTGCCACACTCTTACCACCGGCCAGAACAAGACAAAGTC
TTCTCTGTGTTCTACACCATCCTCACACCCATGCTTAATCCACTCATCTACAGTTTGAGA
AACAAAGATGTAACTGGAGCTATGAAGAGGGTACTGGACAGGTTCAAGCGTACACAGAGA
GTGTCAGGGGATGCTTTT


Conceptual translation

MKKNMLNVFFQLLEIYFLTINLYTVLIPCKHHGFILKILGHTSALMGSMEEYNTSSTDFT
FMGLFNRKETSGLLFAIISIIFFTALMANGVMIFLIRTDSHLHTPMYFLLSHLSFIDMMY
ISTIVPKMLVDYLLDQRTITFVGCTAQHFLYLTLVGAEFFLLGLMAYDRYVAICNPLRYP
ILMSRRVCWMIIAGSWFGGSLDGFLLTPITMSFPFCNSREINHFFCEAPAVLKLACADTA
LYETVMYVCCVLMLLIPFSVVIASYAQILTTVHRMSSVEGRKKAFATCSSHMTVVTLFYG
AAMYTYMLPHSYHRPEQDKVFSVFYTILTPMLNPLIYSLRNKDVTGAMKRVLDRFKRTQR
VSGDAF