Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR2T6 Olfactory Receptor

Gene Symbol OR2T6
Organism Cow
Family 2
Subfamily T
Pseudo No
Location chr7:43,382,400-43,383,400 (+)

Sequence information


Nucleotide sequence

ATGAATGGAAATAATAAGACCTTTTCCAGTGACTTCACCCTTGCAGGGCTCTTCACTAAC
AACAAAGCCTCTGGCTTCCTTTTCAGCATCATTTGTGCCATCTTCTTCATGGCCATAATA
GTTAATGGGGTCGTGATCTTCCTGATCTACATAGACCCTCACCTCCATACCCCCATGTAC
TTCCTGCTCAGCCACCTCTCCTTCATTGACATTATGTACATCTCCACCATTGTGCCCAAG
ATGCTGGCCGATTACCTTGAGGGTGAGAGAACCATATCCTTTATTGCCTGTACAGCCCAA
TACTTTCTCTATATGGGCTTTGTAGGGGCCGAATTTTTCCTCCTGGGACTCATGGCATAT
GACCGCTACGTGGCCATCTGCAACCCTCTCCGCTATCCTGTCCTCATGAGCCATCGGGTC
TGTTGGATGATCTTGGCCAGCTCTTGGTTTGGTGGTGCTTTGGATAGCTTCCTCCTCACC
CCTATAACAATGACTCTACCATTCTGTGCTTCACACAAGATCAACCACTTCTTCTGTGAG
GCACCCACCATGCTGAGGCTGGCCTGTGGTGACAAAGCTGCCTATGAAATGGTGATGTAT
ATTTGCTGTGTCATGATGCTGCTGATCCCCTTCTCTGTAGTGATTGCTTCCTACGCTGGA
GTGCTCATCACAGTGCACCAGATGAAGTCAGCAGAAGGGAAGAAGAAGGCTTTTGCCACC
TGCTCCTCACACATGATGGTGGTGATCTTATTCTATGGGGCTGCCCTGTACACATATATG
CTTCCCCAATCATACCACACTCCAACTAAAGACAAGGTCTTTTCTGTCTTTTACACTATC
ATCACCCCCTTGTTAAACCCTCTCATTTATAGTTTGAGAAACAGGGATGTGGCTGAGGCC
TTTAAGAGGGTTTTGGCAAGATGTCTAGGGACCCATTTTATGACAAGGGGAGAATTC


Conceptual translation

MNGNNKTFSSDFTLAGLFTNNKASGFLFSIICAIFFMAIIVNGVVIFLIYIDPHLHTPMY
FLLSHLSFIDIMYISTIVPKMLADYLEGERTISFIACTAQYFLYMGFVGAEFFLLGLMAY
DRYVAICNPLRYPVLMSHRVCWMILASSWFGGALDSFLLTPITMTLPFCASHKINHFFCE
APTMLRLACGDKAAYEMVMYICCVMMLLIPFSVVIASYAGVLITVHQMKSAEGKKKAFAT
CSSHMMVVILFYGAALYTYMLPQSYHTPTKDKVFSVFYTIITPLLNPLIYSLRNRDVAEA
FKRVLARCLGTHFMTRGEF