Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR2W1 Olfactory Receptor

Gene Symbol OR2W1
Organism Cow
Family 2
Subfamily W
Pseudo No
Location chr23:29698016-29698975 (+)
Aliases OR2W1, ENSBTAG00000015175

Sequence information


Nucleotide sequence

ATGGACCAGAGAAATTATACTTCTCTACATGGCTTCATTCTGCTTGGCTTCTCTGACCAT
CCCAAACTGGAGACGGTCCTGTCAGGAGTTGTCACTGTCTTCTACTTAATTACCTTGGTC
GGTAACACAGCCATCATTCTTGCATCTCTCCTGGATTCCCATCTCCACACACCAATGTAC
TTTTTCCTCCGGAATTTATCTCTCCTAGATCTGTGTTTCACAACCAGCATCGTCCCCCAG
ATGCTGGTTAACTTGTGGGGACATGATAAGACCATCAGCTATGTGGGCTGCATCATTCAG
CTCTATGTTTACATGTGGTTTGGCTCCATTGAGTGCCTTCTCCTAGCTGTTATGTCCTAT
GATCATTTTACAGCTATCTGTAAGCCCTTGCATTATTTGGTCATCATGAACCCACATTTA
TGCCTCAAGATGGTTATCATAGTCTGGAGTATTAGTCTGGCCAATTCTGTGGTATTATGT
ACACTCACCCTGAATTTGCCTAGATGTGGAAACAACCTTCTGGATCATTTCTTGTGTGAG
TTGCCAGCTATGGTCAAGATAGCTTGCATAGACACCACAGCAGTTGAAATGTCTGTTTTT
GCTTTAGGCATTGTCATTGTCCTTACACCACTCGTCCTTATTCTTATATCCTATGGCTAC
ATCACCAAAGCTGTGCTAAGAATGAAATCAAAAGCAGGCCAGAGAAAAGCAATTAATACC
TGTGGATCTCATCTCACCGTAGTGTCCATCTTCTACGGAACTATTATCTACATGTACCTG
CAATCAGGTAACAATGCCTCCAAGGACCAGGGTAAGTTCCTCACTCTCTTTTACACTATC
ATCACTCCAAGTCTCAACCCTCTCATTTATACGTTAAGGAATAAGGACATGAAAGATGCG
CTGAAGAAGCTGATGAGAGTTGACCACAAATCTACAAAATCAAGGAGAAACTGGAAGTCA


Conceptual translation

MDQRNYTSLHGFILLGFSDHPKLETVLSGVVTVFYLITLVGNTAIILASLLDSHLHTPMY
FFLRNLSLLDLCFTTSIVPQMLVNLWGHDKTISYVGCIIQLYVYMWFGSIECLLLAVMSY
DHFTAICKPLHYLVIMNPHLCLKMVIIVWSISLANSVVLCTLTLNLPRCGNNLLDHFLCE
LPAMVKIACIDTTAVEMSVFALGIVIVLTPLVLILISYGYITKAVLRMKSKAGQRKAINT
CGSHLTVVSIFYGTIIYMYLQSGNNASKDQGKFLTLFYTIITPSLNPLIYTLRNKDMKDA
LKKLMRVDHKSTKSRRNWKS