Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR3A4 Olfactory Receptor

Gene Symbol OR3A4
Organism Cow
Family 3
Subfamily A
Pseudo No
Location chr19:24,668,400-24,669,400 (+)

Sequence information


Nucleotide sequence

ATGGATCCGGGAGCCTCAGGAAATGATTCAGTTGTCACTGAGTTTGTCCTGCTGGGGCTC
ACGAAGACCCCAGCTCTACAGCCCATCCTCTTCGTCATCTTCCTCCTCGCTTATGTAGCT
ACTGTGGGGGGCAATTTCAGCATCCTGGCTGCCATCCTCGCTGAACCCAAACTCCACACC
CCCATGTACTTCTTCCTGGGGAACTTGTCCCTGCTGGATGTTGGATGCATCAGTGTCACT
GTCCCTGCCATGCTGGGGCATTTCATGTCCAGTAACAGAAGCATCCTCTATCGGTCCTGC
CTCTCCCAGCTCTTCTTCTTCCACCTCCTGGCCGGGGTGGACTGCTTCCTGCTGACCGTC
ATGGCCTACGACCGCTACCTGGCCATCTGCCAGCCCCTCACCTACAGCACCCACATGAGC
TGGGGAATCCAGCGAGCCCTGGCCGGCATGTCTTGTGTCTTTTCCTTCACCAACGCGCTG
ACTCAAACTGTTGCTGTATCTACTCTGAACTTCTGCGGTCCCAATGTGATCAACCACTTC
TACTGTGACCTCCCACAGCTCTTCCAGCTCTCCTGCTCCAGCATCCAGCTCAACGAGCAG
TTGCTCTTTGTAGCAGCAGCCTTCATGGGTGTGGCCCCCTTAGTCCTCATCACTGTGTCC
TATGGACACGTGGCAGCCGAAGTCCTGCGGATCCGCTCAGCGGAGGGCAGGAAGAAAGCC
TTCTCCACGTGTGGCTCCCACCTCACCGTGGTGGGCATCTTCTATGGCACAGGCGTCTTC
AGCTACATGCGGCTGGGCTCAGGGGAGGCTTCAGACAAGGACAAGGGCATTGGCATCCTC
AACACAGTCATCAGCCCCATGCTGAACCCCGTCATCTACAGCCTCCGAAACCCCGATGTG
CAGGGTGCCCTGAGACGGGTGTTCACAGGGAGACAGCCCCCCACG


Conceptual translation

MDPGASGNDSVVTEFVLLGLTKTPALQPILFVIFLLAYVATVGGNFSILAAILAEPKLHT
PMYFFLGNLSLLDVGCISVTVPAMLGHFMSSNRSILYRSCLSQLFFFHLLAGVDCFLLTV
MAYDRYLAICQPLTYSTHMSWGIQRALAGMSCVFSFTNALTQTVAVSTLNFCGPNVINHF
YCDLPQLFQLSCSSIQLNEQLLFVAAAFMGVAPLVLITVSYGHVAAEVLRIRSAEGRKKA
FSTCGSHLTVVGIFYGTGVFSYMRLGSGEASDKDKGIGILNTVISPMLNPVIYSLRNPDV
QGALRRVFTGRQPPT