Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR4C10G Olfactory Receptor

Gene Symbol OR4C10G
Organism Cow
Family 4
Subfamily C
Pseudo No
Location chr15:79,359,700-79,360,600 (-)

Sequence information


Nucleotide sequence

ATGAAACACATGGAGAACAGGAACAATGTGACGGAGTTTGTTCTTCTGGGGCTCACACAG
AATCCAAAGATGCAGAAAATTGTGTTTGCTGTGTTCTTTGCCATCTACATCACCACTGTG
GTAGGAAATGTGCTCATCATCGTCACCATAACTGCCAGCCCATCTTTGGGATCCCCCATG
TACTTTTTCCTGGCCTATCTCTCCTTTATCGATGCCTGCTACTCCTCTGTGTGTGCCCCT
AAGATGATTGTAGATTCACTCTGTGAAAAGAAAACCATCTTATTTCATGGATGCATGACC
CAAATCTTTGGGGAACATTTCTTTGGAGGTGCTGAAGTCATCCTGCTTACTGTGATGGCC
TATGACCGCTATGTGGCCATCTGCAAGCCCTTGCACTATACAAGCATCATGAACTGGCAG
GTGTGCGGGCTGCTGGTGGGAGTGTCATGGGTGGGAGGCTTTCTTCATGGATTCATACAG
ATCCTCTTCATCTTCCGCTTACCCTTCTGTGGCCCTAACGTCATAGATCACTTTATGTGT
GACCTGAACCCTTTGCTCGGTCTTGCCTGCACTGATACGCACACGCTAGGGCTCTTCATT
GCTGCCAACAGTGGCTTCATCTGTCTGTTAAACTTCCTTCTCCTGCTGGTCTCGTACATG
GTCATCTTGCGTTCCCTAAGGGCCTACAGCTTGGAAGCAAGACGAAAAGCCCTCTCCACC
TGCATCTCCCACATCACAGTGGTCATTTTATACTTCGTGCCCTGCATATTTGTGTACATG
AGACCTGCAGCTACCTTAGCTGTTGATAAAGCAGTTGCTGTATTTTATACTGTGATAACT
CCCATGTTAAATCCCTTAATCTATACCTTGAGAAATGCCCAGATGGAAAATGCCATTAGG
AAATTGTGTAGTAGGAAAGTTACTTCAGGTGTCTTA


Conceptual translation

MKHMENRNNVTEFVLLGLTQNPKMQKIVFAVFFAIYITTVVGNVLIIVTITASPSLGSPM
YFFLAYLSFIDACYSSVCAPKMIVDSLCEKKTILFHGCMTQIFGEHFFGGAEVILLTVMA
YDRYVAICKPLHYTSIMNWQVCGLLVGVSWVGGFLHGFIQILFIFRLPFCGPNVIDHFMC
DLNPLLGLACTDTHTLGLFIAANSGFICLLNFLLLLVSYMVILRSLRAYSLEARRKALST
CISHITVVILYFVPCIFVYMRPAATLAVDKAVAVFYTVITPMLNPLIYTLRNAQMENAIR
KLCSRKVTSGVL