Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR4C3 Olfactory Receptor

Gene Symbol OR4C3
Organism Cow
Family 4
Subfamily C
Pseudo No
Location chr15:79276431-79277354 (-)
Aliases OR4C3, ENSBTAG00000012549

Sequence information


Nucleotide sequence

ATGGAAATACCACACAACATCACAGAATTTTTCATGCTGGGACTTTCACAGAACCCAGAA
GTGCAAAGAGCTCTCTTTGTGGCCTTTTTGACCATATATGGGATCACAGTTTGTGGCAAT
ATTCTCATTGTGATCACCATCACCTGTAATCCCACGCTGGATTCCCCTATGTATTTTTTC
CTGGCCAACCTTTCCTTTATTGATACCTGTTATTCTTCTTCTATGGCCCCTAGACTCATA
GCTGACTCCTTGTATGAGGGGAGAGCCATCTCCTATGAGGGTTGCATGGCTCGGCTCTTT
GGAGCTCATTTTTTTGGAGGTGCTGAGATCATCCTGCTCACAGTGATGGCCTATGACCGC
TACGTGGCCATCTGCAAGCCCCTGCACTACACGGCCATCATGACCAGGCATCTCTGTGCC
CTGCTGGTGGGGCTGGCTTGGCTGGGGGGCTTCCTGCATTCCCTGGTTCAGCTCCTGCTG
GTCCTGCAGTTGCCCTTCTGCGGGCCTAACGTGATCAATCACTTTGTCTGTGACTTGTAC
CCCTTGCTGGAACTTGCCTGCACTGACACCTATGTCATCGGCCTGCTGGTGGTGGCCAAC
AGTGGCGTGATCTGCCTGTTGAACTTCCTCCTGCTGGCTGCCTCCTACCTGGTCATCCTG
TGCTCCTTGAGGTCCCACAGCGCAGAGGGGAGGCGCAGGGCCCTCTCCAGCTGCGGGGCC
CACTTCACGGTTGTTGCCTTGTTCTTCGTGCCCTGTATGTTTACTTATGTGCGGCCGTCA
TCTAATTTATCTATAGACAAAAACATGGCAGTATTTTATGGTATCCTGACTCCCATGTTG
AATCCACTCATTTACACTCTGAGAAATGAAGAGGTAAAGAATGCCTTGACAAAGTTCTTC
ACACAGCAAGATCTTAAATGTAGC


Conceptual translation

MEIPHNITEFFMLGLSQNPEVQRALFVAFLTIYGITVCGNILIVITITCNPTLDSPMYFF
LANLSFIDTCYSSSMAPRLIADSLYEGRAISYEGCMARLFGAHFFGGAEIILLTVMAYDR
YVAICKPLHYTAIMTRHLCALLVGLAWLGGFLHSLVQLLLVLQLPFCGPNVINHFVCDLY
PLLELACTDTYVIGLLVVANSGVICLLNFLLLAASYLVILCSLRSHSAEGRRRALSSCGA
HFTVVALFFVPCMFTYVRPSSNLSIDKNMAVFYGILTPMLNPLIYTLRNEEVKNALTKFF
TQQDLKCS