Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR4D2E Olfactory Receptor

Gene Symbol OR4D2E
Organism Cow
Family 4
Subfamily D
Pseudo No
Location chr19:9316127-9317059 (+)
Aliases LOC788713, ENSBTAG00000045769

Sequence information


Nucleotide sequence

ATGGATTCAGGGAACCTCACGTGGGTATCAGAATTTGTCTTCCTAGGGTTCTCACAGTAT
CAGGAACTCCAGCTTTTCTTATTTCTGGTGTTCCTGCTTGTCTACACCACCACTGTCGTG
GGAAACCTCCTCATCATGGTGACAGTGACCTCTGATTCCAGGCTCCACACACCCATGTAT
TTCCTGCTGAGAAACCTGGCTGTCATAGATGTCTGCTTCTCCTCAGTCACTGCCCCAAAG
ATGCTGGTGGACATCCTTGCTGAGAAGAAGACCATCTCCTACCAGGGCTGCATGGCCCAG
ATCTTCTTCTTCCACTTTCTGGGAGGTGGGACTCTCCTCTTCCTCTCAGTGATGGCCTAT
GACCGTTACATAGCCATCTCCCGGCCCCTTCACTATGTCACCATCATGAACACTCGAGTG
TGTGTGGGGCTGGTGGTGGCTGCCTGGGTAGGAGGCTTTGTCCACTCCGTTGCCCAGCTG
ATTCTGATGCTGCCATTGCCTTTCTGTGGACCCAACATCCTAGATAACTTCTACTGTGAT
GTTCCACAAGTACTGAGGCTTGCCTGCACAGATACCTCCCTCCTGGAGTTCCTTATGATC
TCCAACAGTGGGATGCTGGTCCTCATCTGGTTTCTCCTCCTTCTGATCTCTTACACAGTC
ATTCTGGTGATGCTGAGGTCCCACTCTGGGCAGGCGAGGAGGAAGGCAGCTTCCACCTGC
ACCATCCACATCATTGTTGTGTCTATGGTCTTCATTCCTTGTATCTATATTTATGCCCGG
CCCTTCACCTCTTTCCCCATAGACAAAGCTGTGTCCATCAGTCAAACAGTTATCACCCCC
ATGCTCAACCCAATGATCTACACCCTGAGGAACCAGGAGATGCAGGCAGCAGTGAAGAGA
TTAGGCAAGCGCCTAGTGATTTCCAGGAGGGAG


Conceptual translation

MDSGNLTWVSEFVFLGFSQYQELQLFLFLVFLLVYTTTVVGNLLIMVTVTSDSRLHTPMY
FLLRNLAVIDVCFSSVTAPKMLVDILAEKKTISYQGCMAQIFFFHFLGGGTLLFLSVMAY
DRYIAISRPLHYVTIMNTRVCVGLVVAAWVGGFVHSVAQLILMLPLPFCGPNILDNFYCD
VPQVLRLACTDTSLLEFLMISNSGMLVLIWFLLLLISYTVILVMLRSHSGQARRKAASTC
TIHIIVVSMVFIPCIYIYARPFTSFPIDKAVSISQTVITPMLNPMIYTLRNQEMQAAVKR
LGKRLVISRRE