Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR4F1 Olfactory Receptor

Gene Symbol OR4F1
Organism Cow
Family 4
Subfamily F
Pseudo No
Location chr10:27,882,300-27,883,200 (-)

Sequence information


Nucleotide sequence

ATGGATGGAGGGAATCACTCGGTGTCTGAGTTTGTGTTTCTGGGACTCACTTATTCTTGG
GGGATCCAGCTGCTCCTCCTGGTGTTCTCCTCTGTGTTCTATGTGGCAAGCATGGCTGGA
AACATCCTCATTGTGTTTTCTGTGACTACTGATCCTCACTTACATTCCCCCATGTACTTC
CTACTGGCCAGCCTCTCCTTCATTGACTTGGGAGCCTGCTCTGTCACTTCTCCCAAGATG
ATCTATGACCTTTTCAGAAAGCGTAAAGTCATTTCTTTTGGAGGCTGCATTGCTCAGATC
TTCTTCATCCATGTCATTGGTGGGGTGGAGATGGTGCTGCTCATAGCCATGGCCTTTGAC
AGATATGTTGCCATATGTAAGCCTCTCCACTATCTGAGCATCATGAGCCCAAGGATGTGC
ATTTTGTTTCTGGCTGCTGCCTGGGCCCTTGGTGTCAGCCACTCACTGTTCCAGCTAGCA
TTTATTGTTAATTTGCCCTTCTGTGGTCCGAATGTATTGGACAGCTTTTACTGTGATCTT
CCTCGGCTCCTCAGACTGGCCTGTACAGATACTTACAGACTTCAGTTCATGGTCACTGTC
AACAGTGGGTTTATCTGTGTTAGTTCCTTCTTTATACTTCTCATCTCCTATATGTTCATC
CTGTTAACTGTTTGGAAACGCTCCTCAGGTGGTTCGCCCAAGGCCCTGTCCACTTTGTCA
GCTCACATCACTGTGGTTATTTTGTTCTTTGGTCCAACCATGTTTGTCTATACATGGCCG
CACCCCAATTCCCAAATGGACAAGTTTCTTGCTCTTTTTGATGCGGTTCTTACTCCTTTC
TTGAATCCAGTTATTTATACATTCAGGAATAAAGAGATGAAAGCAGCAATGAAGAGAGTA
TGCAAACAGCTAGTGATTTATGGGACGATTTCA


Conceptual translation

MDGGNHSVSEFVFLGLTYSWGIQLLLLVFSSVFYVASMAGNILIVFSVTTDPHLHSPMYF
LLASLSFIDLGACSVTSPKMIYDLFRKRKVISFGGCIAQIFFIHVIGGVEMVLLIAMAFD
RYVAICKPLHYLSIMSPRMCILFLAAAWALGVSHSLFQLAFIVNLPFCGPNVLDSFYCDL
PRLLRLACTDTYRLQFMVTVNSGFICVSSFFILLISYMFILLTVWKRSSGGSPKALSTLS
AHITVVILFFGPTMFVYTWPHPNSQMDKFLALFDAVLTPFLNPVIYTFRNKEMKAAMKRV
CKQLVIYGTIS