Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR4K2 Olfactory Receptor

Gene Symbol OR4K2
Organism Cow
Family 4
Subfamily K
Pseudo No
Location chr10:27,303,100-27,304,000 (+)

Sequence information


Nucleotide sequence

ATGATGGATTTGGTGAACAAGTCTACAGTTTCTGATTTTGTTTTGCTAGGACTCTCTAAA
TCCTGGAAACTACAGACATTTTTCCTCGTGGTGTTTTTGCTCTTTTATGTGACAACAATG
GTGGGTAATAGCCTCATAGTCATCACAGTGATATCAGACTCTCATCTGCACTTCCCCATG
TACTTCCTGCTCACCAACCTTTCCATCATTGATATGTCTCTTGCTTCCTTTGCAACCCCT
AAGATGATTACAGACTACCTCAGTGGACACAAAACCATCTCCTTTGATGGTTGCATCACC
CAGATATTTTTTCTACACCTTTTTACTGGCACTGAGATTATTTTGCTAATGGCCATGTCT
TTTGATAGGTATATTGCAATATGCAAGCCTCTTCACTATGCTTCAATCATAAGTCCCCAG
ATGTGTGTTGCCCTTGTGGTGGTTTCCTGGGTTGTAGGAGTCATGCATTCAATGAGCCAG
GTCATATTTGCTCTCACATTGCCCTTCTGTGGTCCCAATGAGGTAGATAGCTTTTTCTGT
GACCTTCCTGTGGTGTTCCAACTAGCATGTGTAAATACTTATGTCCTGGGCCTCTTTATG
ATCTCAACAAGTGGCATCATTGCCTTGTCCTGCTTTATTCTTCTATTCAGTTCCTATGTT
ATTGTCTTGGTTACTATCAGAAATCATTCTTCAAAAGGAACATCTAAGGTTCTTTCTACC
TGCACAGCTCATTTCATTGTGGTTTTCATGTTCTTTGGGCCCTGCATCTTCATCTATATG
TGGCCACTAAGCAGTTTTCTGATAGACAAGATTCTATCTGTGTTTTATACCATCTTTACT
CCCATTCTGAACCCAGTAATCTATACTTTGAGAAATCAGGAAGTGAAACAGCCA


Conceptual translation

MMDLVNKSTVSDFVLLGLSKSWKLQTFFLVVFLLFYVTTMVGNSLIVITVISDSHLHFPM
YFLLTNLSIIDMSLASFATPKMITDYLSGHKTISFDGCITQIFFLHLFTGTEIILLMAMS
FDRYIAICKPLHYASIISPQMCVALVVVSWVVGVMHSMSQVIFALTLPFCGPNEVDSFFC
DLPVVFQLACVNTYVLGLFMISTSGIIALSCFILLFSSYVIVLVTIRNHSSKGTSKVLST
CTAHFIVVFMFFGPCIFIYMWPLSSFLIDKILSVFYTIFTPILNPVIYTLRNQEVKQP