Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR4N2 Olfactory Receptor

Gene Symbol OR4N2
Organism Cow
Family 4
Subfamily N
Pseudo No
Location chr10:***************** (+)
Aliases LOC510931, ENSBTAG00000032789

Sequence information


Nucleotide sequence

ATGGAGAATGAGAACAGTACGGAGGTGACAGAATTCATCCTTGCTGGTCTGACTCAGTCT
CAAAATATTCAGCTCCTGGTGTTTGCCCTAGTCTTAATTTTCTACCTCATCATCCTCCCT
GGAAATTTCCTCATCATCCTCACCATCAGGTCAGACCCCAGTCTCACGGCCCCGCTCTAC
TTCTTCCTGGGCAACCTGGCCTTCCTGGATGCATCCTACTCCTTCATTGTGGCTCCCAGG
ATGCTGGTGGACTTCCTCTCTGAGAAGAAGGTGATCTCCTATAGAGCCTGCATCACTCAG
CTCTTCTTCTTGCACTTTCTTGGAGGAGGGGAGGGATTACTCCTTGTCGTGATGGCCTTT
GACCGCTACATTGCCATCTGTCGTCCTTTACACTATTCGACTGTCATGAACCCTAGAGCC
TGCTATGCCTTGCTGTTGGCTCTGTGGCTTGGAGGCTTTGTTCATTCCATTATCCAAGTG
GCCCTCATCCTCCGCTTGCCCTTCTGTGGTCCAAACCGACTGGACAACTTCTTCTGTGAT
GTGCCGCAGGTCATCAAGCTGGCCTGCACTGACACCTTTGTGGTGGAGCTGCTGATGGTC
TTCAACAGTGGTCTGATGACCCTCCTGTGCTTCCTGGGCCTTCTGGCCTCCTATGCAGTC
ATCCTCTGCCGTGTACATGGCTCCTCCTCTGAGGGGAAGAGCAAGGCGCTGTCCACGTGC
ACCACCCACATCATCGTTATATTTCTCATGTTCGGGCCTGGCATCTTTATCTACACCCGC
CCCTTCAGAGCCTTCCCAGCTGACAAGGTGGTTTCTCTCTTCCACACAGTGATCTTTCCC
CTGTTAAACCCTGTGATTTATACTCTTCGCAACCAGGAAGTAAAATCGTCTGTGAAAAGG
CTGTTTAGTCAGCACTTAGCC


Conceptual translation

MENENSTEVTEFILAGLTQSQNIQLLVFALVLIFYLIILPGNFLIILTIRSDPSLTAPLY
FFLGNLAFLDASYSFIVAPRMLVDFLSEKKVISYRACITQLFFLHFLGGGEGLLLVVMAF
DRYIAICRPLHYSTVMNPRACYALLLALWLGGFVHSIIQVALILRLPFCGPNRLDNFFCD
VPQVIKLACTDTFVVELLMVFNSGLMTLLCFLGLLASYAVILCRVHGSSSEGKSKALSTC
TTHIIVIFLMFGPGIFIYTRPFRAFPADKVVSLFHTVIFPLLNPVIYTLRNQEVKSSVKR
LFSQHLA