Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR4N2C Olfactory Receptor

Gene Symbol OR4N2C
Organism Cow
Family 4
Subfamily N
Pseudo No
Location chr10:***************** (+)
Aliases OR4N4, ENSBTAG00000046390

Sequence information


Nucleotide sequence

ATGAAGATAGAAAATAGCACAGCGGTGACAGAATTCATTCTCCTTGGTCTGACCCAGTCT
CAAAATATTCAGCTCCTGGTCTTTGTCCTGATCTTAATTTTCTACCTCATCATCCTCCCT
GGAAATTTCCTCATCATCCTCACCATCAGGTCAGACCCTGGCCTCACAGCCCCCCTCTAC
TTCTTCCTGGGCAACCTGGCCTTCCTGGATGCATCCTACTCCTTCATTGTGGCTCCCAGG
ATGCTGGTGGACTTCCTCTCTGAGAAGAAGGTGATCTCCTATAGAGGCTGCATCACTCAG
CTCTTCTTCTTGCACTTCCTTGGAGGAGGGGAGGGATTACTCCTTGTCGTGATGGCCTTT
GACCGCTACATTGCCATCTGTCGTCCTTTACACTATTCGACTGTCATGAACCCTAGAACC
TGCTATGCCTTGCTGTTGGTTCTGTGGCTCGGCGGCTTTGTTCATTCCATTATCCAAGTG
GCCCTCATCCTCCGCTTGCCCTTCTGTGGTCCAAACCGACTGGACAACTTCTTCTGTGAT
GTGCCGCAGGTCATCAAGCTGGCCTGCACTGACACCTTTGTGGTGGAGCTGCTGATGGTC
TTCAACAGTGGCCTGCTCACCCTGCTGTGCTTTCTGGGCCTGCTGGCCTCCTATGCAATC
ATCCTCTGCCGTATAAGCGGGTCTGCTTCTGAAGGGAAGAGCAAGGCGCTGTCCACATGC
ACCACTCATGTCATCATTATACTTCTCATGTTTGGGCCTGCCATCTTTATCTACACTCGT
CCCTTCACAGCCTTATCAGCAGACAAGGTGGTTTCCTTTTTCCACACAGTGATCTTTCCT
TTGATGAATCCTGTGATTTATACCCTTCGCAACCAGGAAGTGAAAGCTTCCATGAGGAGG
ATATTGAGCCGGCATGTGTTTTTC


Conceptual translation

MKIENSTAVTEFILLGLTQSQNIQLLVFVLILIFYLIILPGNFLIILTIRSDPGLTAPLY
FFLGNLAFLDASYSFIVAPRMLVDFLSEKKVISYRGCITQLFFLHFLGGGEGLLLVVMAF
DRYIAICRPLHYSTVMNPRTCYALLLVLWLGGFVHSIIQVALILRLPFCGPNRLDNFFCD
VPQVIKLACTDTFVVELLMVFNSGLLTLLCFLGLLASYAIILCRISGSASEGKSKALSTC
TTHVIIILLMFGPAIFIYTRPFTALSADKVVSFFHTVIFPLMNPVIYTLRNQEVKASMRR
ILSRHVFF