Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR4Q3 Olfactory Receptor

Gene Symbol OR4Q3
Organism Cow
Family 4
Subfamily Q
Pseudo No
Location chr10:27,201,600-27,202,600 (+)

Sequence information


Nucleotide sequence

ATGAAAAAAGAAAATGATTCTAAGGTGACAGAATTTGTTCTTCTGGGTCTATCATCATCC
TTGGAGCTGCAGCTATTTCTCTTCTTAATATTTCTGTTGTTTTACATGGCCATTGTCCTG
GGAAACCTCTTGATAGTGGTAACGGTGCGAGCTGATACTCACCTGCTCCAATCACCTATG
TACTATTTTTTGGGCCACCTGTCCTTCATTGACCTATGCCTGAGCTGTGTTACTGTGCCC
AAGATGTTAGGAGATTTCGTACAGGAGGACAAGATCATCTCTTTTTCCGGATGCCTGGCC
CAGATCTGCTTCCTGCACTTTCTGGGAGCCAGTGAGATGTTTCTGCTGACAGCCATGGCC
TATGATAGGTATGTTGCCATATGTAATCCTTTGCAGTACCTGACAGTCATGAACCACCAG
CTGTGCCTTCAGATGGTTTTTGCCTGTTGGTGTGGGGGTTTTGTCCATTCTATCACACAG
GTCACACTGGTCATTCAGCTGCCCTTCTGTGGGCCCAATAAACTGGACAACTTCTACTGT
GACGTCCCACAGGTCATCAAGCTAGCCTGCACAGACACATATGTAGTAGAAGTGCTGATG
GTCTCGAACAGTGgtctattgtctcttgtctgtttcttggttttgctcttCTCTTATGCT
GTCATCCTGGTCACCCTGAGAACTCGCTTCCGCCAGGGCCAGAACAGGGCACTCTCTACC
TGTGCCTCCCACCTAACAGTGGTCAGTCTGATCTTTGTGCCGTGTGTATTCATCTACCTG
AGACCTTTCTGCAGCTTCTCTGTGGACAAAGTTTTCTCTGTCTTCTACACAGTGATCACA
CCTATGTTGAACCCCCTCATTTATACTCTCAGAAACACTGATATGAAGACAGCTATGAAG
AAGCTGAGAAAAAAACATGTGACATCCTGCTGCCATGTCCAAGAA


Conceptual translation

MKKENDSKVTEFVLLGLSSSLELQLFLFLIFLLFYMAIVLGNLLIVVTVRADTHLLQSPM
YYFLGHLSFIDLCLSCVTVPKMLGDFVQEDKIISFSGCLAQICFLHFLGASEMFLLTAMA
YDRYVAICNPLQYLTVMNHQLCLQMVFACWCGGFVHSITQVTLVIQLPFCGPNKLDNFYC
DVPQVIKLACTDTYVVEVLMVSNSGLLSLVCFLVLLFSYAVILVTLRTRFRQGQNRALST
CASHLTVVSLIFVPCVFIYLRPFCSFSVDKVFSVFYTVITPMLNPLIYTLRNTDMKTAMK
KLRKKHVTSCCHVQE