Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR51A4B Olfactory Receptor

Gene Symbol OR51A4B
Organism Cow
Family 51
Subfamily A
Pseudo No
Location chr15:50,789,300-50,790,200 (+)

Sequence information


Nucleotide sequence

ATGTCCATTATCAACATATCACATGCTGAAATCACCACCTTTATCTTGGTTGGGATGCCG
GGGCTGGAATATGCACACATCTGGATCTCTATTCCAATGTACAGCATGTATCTTATTGCT
CTTCTGGGAAACTGCACCATCCTTTTCATCATTAAGACAGAACCATCCTTGCATGAGCCC
ATGTACTATTTCCTTTCCATCTTGACTTTGTCTGACATGGGCCTATCCTTTTCCTCTCTT
CCCACTATGTTGAGGATCTTCTTATTTAAAGCTTCTGAAATCTCTGCAAATGCCTGCTTT
GCTCAGCAATTCTTCATCCATAGATTCACAGCACTGGAATCCTCAGTGCTCCTGATCATG
TCGTTCGATTGCGTCCTAGCCATCCACAACCCTCTGAGATACAGCTCCCTTCTTACAACT
CTCAGAGTTGCCCAAATTGGAATTGTATACTTTTTCAAGAGCTTCCTCCTGGTTCTTCCC
TTTCGCTTCACTTTGAGAATGTTGAAATATTGTGAGAAACGCCAATTATCACATTCCTAC
TGTCTCCACCAGGATGTCGTGAAGCTGGCCTGCTCTGACAACCAGATTGATGTCATTTAT
GGCTTTTTTGGAGCACTCTGCCTTATGGTAGACTTTATGCTCATTGCTGTGTCTTACATT
CTAATCCTCAAGACTGTGCTTGGAATTGCATCCCAAAAGGAACAGCTCAAGGCCCTCAAT
GCTTGTGTTTCACACATCTGTGCAGTGATCATCTTCTATCTGCCCATCATCAACCTTGCC
ATTGTTCATCCTTTTGTCCAGCATGTCTCTCCCCTCTTCAATGTTCTTATGGCAAATGTT
CTTTTACTTGTGCCTCCACTGATGAATCCCATTGTGTACTGTGTCAAAACCAGGCAGATT
AGAGTAAAAGTTGTAGCAAAATTATGTCAGAAACAAATATAT


Conceptual translation

MSIINISHAEITTFILVGMPGLEYAHIWISIPMYSMYLIALLGNCTILFIIKTEPSLHEP
MYYFLSILTLSDMGLSFSSLPTMLRIFLFKASEISANACFAQQFFIHRFTALESSVLLIM
SFDCVLAIHNPLRYSSLLTTLRVAQIGIVYFFKSFLLVLPFRFTLRMLKYCEKRQLSHSY
CLHQDVVKLACSDNQIDVIYGFFGALCLMVDFMLIAVSYILILKTVLGIASQKEQLKALN
ACVSHICAVIIFYLPIINLAIVHPFVQHVSPLFNVLMANVLLLVPPLMNPIVYCVKTRQI
RVKVVAKLCQKQIY