Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR51A4P Olfactory Receptor

Gene Symbol OR51A4P
Organism Cow
Family 51
Subfamily A
Pseudo Yes
Location chr15:50,850,900-50,851,900 (+)

Sequence information


Nucleotide sequence

ATGTCCATTATCAACGTATCACATGCTGAAATCACCACCTTCATCTTGGTTGGGATGCCG
GGGCTGGAATATGCACACATCTGGATCTCTATTCCAATATGCAACATGTATCTTATTGCT
CTTCTGGGAAACTGCATCATCCTTTTCATCATTAAGACAGAACCATCCCTGCATGAGCCC
ATGTACTATTTCCTTTCCATGTTGACTTTGTCTGACATGGGCCTATCCTTTTCCTCTCTT
CCCACTATGTTGAGGATCTTCTTATTTAAAGCTTCTGAAATCTCTGCAAATGCCTGCTTT
GCTCAGCAATTCTTCATCCATGGATTCACAGCACTGGAATCCTCAGTGCTCCTGATCATG
TCATTCGATCGCTTCCTAGCCATCCACAACCCTCTGAGATACAGCTCCCTTCTTACAACT
CTCAGAGTTGCCCAAATTGGAATTGTATGCTTTTTCAAGAGCTTCCTCCTGGTTATTCCC
TTTCCCTTCACTTTGAGAATGTTGAAATATTGTGAGAAACGCCAACTATCACATTCCTAC
TGTCTCCACCAGGATGTCATGAAGCTGGCCTGCTCTGACAACCAGATTGATGTCATTTAT
GGCTTTTTTTGAGCACTCTGCCTTATGGTAGACTTTATGCTCATTGCTGTGTCTTACATC
CTAATCCTCAAGACTGTGCTTGGAATTGCATCCCAAAAGGAACAGCTCAAGGCCCTCAAT
ACTTGTGTTTCACACATCTGTGCAGTGATCATCTTCTATCTGCCCATCATCAACCTTGCC
ATTGTTCATCGTTTTGTCCAGCATGTCTCTCCCCTCTTCAATGTTCTTATGGCAAATGTT
CTTTTACTTGTGCCTCCACTGATGAATCCCATTGTGTACTGTGTCAAAACCAGGCAGATT
AGAGTAAAAGTTGTAGCAAAATTATGTCAGAAACAAATATAT


Conceptual translation

MSIINVSHAEITTFILVGMPGLEYAHIWISIPICNMYLIALLGNCIILFIIKTEPSLHEP
MYYFLSMLTLSDMGLSFSSLPTMLRIFLFKASEISANACFAQQFFIHGFTALESSVLLIM
SFDRFLAIHNPLRYSSLLTTLRVAQIGIVCFFKSFLLVIPFPFTLRMLKYCEKRQLSHSY
CLHQDVMKLACSDNQIDVIYGFF*ALCLMVDFMLIAVSYILILKTVLGIASQKEQLKALN
TCVSHICAVIIFYLPIINLAIVHRFVQHVSPLFNVLMANVLLLVPPLMNPIVYCVKTRQI
RVKVVAKLCQKQIY