Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR51A5 Olfactory Receptor

Gene Symbol OR51A5
Organism Cow
Family 51
Subfamily A
Pseudo No
Location chr15:50,767,600-50,768,600 (+)

Sequence information


Nucleotide sequence

ATGTCTATCTTCAACACCTCTGAAACTGATATCGCTACCTTCTTCCTCATTGGAATCCCA
GGGCTGGAGTCTGCCAACATTTGGGTCTCCATTCCCATCTGTCTCATGTACATTGTTGCC
ATCATGGGGAACTGCACCATCCTCTTTTTCATAAAAATGGAGCCTTCTCTGCATGAACCC
ATGTATTATTTTCTATCTATGTTGGCTGTCTCTGACCTGGGACTGTCCTTCTCCTCTCTC
CCTACCATGCTAAGAATATTCTTGTTCAATGCTCCAGGAATTTCCCCCAATGCCTGTATT
GCCCAAGAGTTTTTCATTCATGGATTTTCAGCTATGGAATCATCAGTACTTCTCATCATG
TCTTTTGATCGCTTTATTGCCATCTGCAATCCTCTGAGATACGCTTCTATCCTAACCAGT
ACCAGAGTCATAAAAATAGGCCTTGTCTTTTCTCTCAAAAATGTTTTGTTGATCCTTCCT
TTCCCTTTCACTCTGAAACATCTAAGATACTGTAAGAAGAATCTCCTTTCCCATTCTTAC
TGCCTCCATCAGGATGTCATGAAGCTGGCTTGCTCTGACAACAAGATTAATGTCATTTAT
GGCTTGTTTGTGGCTCTCACAGGCATCCTAGACATAACATGTATTTTCATGTCCTACATG
CTGATACTTAAAGCAGTGTTGGGCATAGCATCACAGAATGAAAGGCTCAAAGTCCTCAAT
ACATGTGTTTCCCACATCATTGCTGTGCTCATCTTCTATGTTCCCATTATCTCCCTATCT
GTCATCTACCGGTTTGCCAAATACAGTTCCCCAATGGTTAAAATCCTCATGGCTGATGTA
TTCCTGCTGGTACCTCCATTGATGAACCCCGTTATATACTGTGTGAAGAACCAGCAGATA
AGAAATTTGATTTTAATGAAACTGTGTCAAAAATACAGC


Conceptual translation

MSIFNTSETDIATFFLIGIPGLESANIWVSIPICLMYIVAIMGNCTILFFIKMEPSLHEP
MYYFLSMLAVSDLGLSFSSLPTMLRIFLFNAPGISPNACIAQEFFIHGFSAMESSVLLIM
SFDRFIAICNPLRYASILTSTRVIKIGLVFSLKNVLLILPFPFTLKHLRYCKKNLLSHSY
CLHQDVMKLACSDNKINVIYGLFVALTGILDITCIFMSYMLILKAVLGIASQNERLKVLN
TCVSHIIAVLIFYVPIISLSVIYRFAKYSSPMVKILMADVFLLVPPLMNPVIYCVKNQQI
RNLILMKLCQKYS