Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR51A7 Olfactory Receptor

Gene Symbol OR51A7
Organism Cow
Family 51
Subfamily A
Pseudo No
Location chr15:50747279-50748214 (-)
Aliases OR51A7, ENSBTAG00000047714

Sequence information


Nucleotide sequence

ATGGCTGTTCTCAATAACTCTGAGGTCCAACTTTTCCTTCTGATTGGAATTCCAGGATTG
GAACATGCCCACGAGTGGATCTCCATTCCCATTTGCCTCCTATATCTGGTTGCCATCATG
GGCAACAGTACCATTCTCTTTATCATAAAGACAGAGCCCTCACTTCATGAACCCATGTAT
TATTTTCTTGCCATGTTGGCTATCTCTGACCTGGGCCTGTCCTTCTCCTCTCTCCCTACC
ATGCTGAGAATCTTCTTGTTCAATGCCATGGAAATTTCACCCAATGCCTGCTTTGCTCAA
GAATTTTTCATCCATGGATTCACAGTCATGGAGTCCTCAGTACTGCTGGTTATGTCTTTG
GATCGCTTTCTTGCCATTCACAATCCCCTGAGATATAATTCTCTCCTCACTAGCAACAGA
GTTGCTAAAATGGGACCGATTTTAGCCACCAGGAGCCTTCTCTTAGTGCTTCCATTTCCT
TTCATGCTAAGGAGATTGAAATATTGTCAGAAGAATGTCCTTTCTTACTCATACTGTCTT
CATCAGGATACCATGAAGCTGGCCTGCTCTGACAACAAGATCAATGTTATCTATGGTTTC
TTTGTTGCTCTCTGTACTATGCTGGACTTGGCTTTCATTATTCTTTCTTATACACTGATC
CTGAAGACTGTACTCAGCATTGCATCTTTGGCAGAGAGACATAAGACCCTGAACACCTGT
GTCTCCCATTTCTGTGCTGTACTCATTTTCTATGTGCCCATCATTACTCTGGCTGCCATG
CATCGCTTTGCCAAGCACAAAAGCCCCCTCGCTATAATCCTTATTGCAGACATATTCTTG
TTGTTGCCACCCCTAATGAACCCCATTGTGTATTGTGTAAAGACTCAACAAATCTGGGAG
AAGGTCTTGGGGAAGCTATCTAACGTATATAGGAGA


Conceptual translation

MAVLNNSEVQLFLLIGIPGLEHAHEWISIPICLLYLVAIMGNSTILFIIKTEPSLHEPMY
YFLAMLAISDLGLSFSSLPTMLRIFLFNAMEISPNACFAQEFFIHGFTVMESSVLLVMSL
DRFLAIHNPLRYNSLLTSNRVAKMGPILATRSLLLVLPFPFMLRRLKYCQKNVLSYSYCL
HQDTMKLACSDNKINVIYGFFVALCTMLDLAFIILSYTLILKTVLSIASLAERHKTLNTC
VSHFCAVLIFYVPIITLAAMHRFAKHKSPLAIILIADIFLLLPPLMNPIVYCVKTQQIWE
KVLGKLSNVYRR