Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR51A7CP Olfactory Receptor

Gene Symbol OR51A7CP
Organism Cow
Family 51
Subfamily A
Pseudo Yes
Location chr15:49,735,000-49,735,900 (+)

Sequence information


Nucleotide sequence

CATGGCTGTTCTCAATAACTCTGAGGTCCAACTTTTCCTTCTGATTGGAATTCCAGGATT
GGAACATGCCCACGAGTGGATCTCCATTCCCATTTGCCTCCTATATCTGGTTGCCATCAT
GGGCAACAGTACCATTCTCTTTATCATAAAGACAGAGCCCTCACTTCATGAACCCATGTA
TTATTTTCTTGCCATGTTGGCTATCTCTGACCTGGGCCTGTCCTTCTCCTCTCTCCCCAC
CATGCTGAGAATCTTCTTGTTCAATGCCATGGAAATTTCACCCAATGCCTGCTTTGCTCA
AGAATTTTTCATCCATGGGTTCACAGTCATGGAGTCCTCAGTACTGCTGGTTATGTCTTT
GGATCGCTTTCTTGCCATTCACAATCCCCTGAGATATAATTCTCTCCTCACTAGCAACAG
AGTTGCTAAAATGGGACCGATTTTAGCCACCAGGAGCCTTCTCTTAGTGCTTCCATTTCC
TTTCATGCTAAGGAGATTGAAATATTGTCAGAAGAATGTTCTTTCTCACTCATACTGTCT
TCATCAGGATACCATGAAGCTGGCCTGCTCTGACAACAAGATCAATGTTATCTATGGTTC
TTTGTTGCTCTCTGTACTATGCTGGACTTGGCTTTCATTGTTCTTTCTTATACACTGATC
CTGAAGACTGTACTCAGCATTGCATCTTTGGCAGAGAGACTTAAGACCCTGAATACCTGT
GTCTCCCATTTCTGTGCTGTACTCATTTTCTATGTGCCCATCATTACACTGGCTGCCATG
CACCGCTTTGCCAAGTACAAAAGCCCCCTTGCTATAATCCTTATTGCACACATATTCTTG
TTGTTGCCACCCCTAATGAACCCCATTGTGTATTGTGTAAAGACTTAACAAATCCGGGAG
AAAGTCTTGGAGAAGCTATCTAACGTATGTaggaga


Conceptual translation

MAVLNNSEVQLFLLIGIPGLEHAHEWISIPICLLYLVAIMGNSTILFIIKTEPSLHEPMY
YFLAMLAISDLGLSFSSLPTMLRIFLFNAMEISPNACFAQEFFIHGFTVMESSVLLVMSL
DRFLAIHNPLRYNSLLTSNRVAKMGPILATRSLLLVLPFPFMLRRLKYCQKNVLSHSYCL
HQDTMKLACSD/QDQCYLWFFVALCTMLDLAFIVLSYTLILKTVLSIASLAERLKTLNT
CVSHFCAVLIFYVPIITLAAMHRFAKYKSPLAIILIAHIFLLLPPLMNPIVYCVKT*QIR
EKVLEKLSNVCRR