Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR51F5 Olfactory Receptor

Gene Symbol OR51F5
Organism Cow
Family 51
Subfamily F
Pseudo No
Location chr15:49,355,000-49,355,900 (-)

Sequence information


Nucleotide sequence

ATGCCATCGTTCAATCAGAGCACTTTCCACCCTACAGTCTTCTTTCTTACTGGCATCCCT
GGTTTTGAAACCTACCATGCCTGGATTTTCATCCCATTCTGTTGTCTCTATGTCATTGCT
ATCTCAGGGAATGGCATGATCTTGTTCATAATCATCACTGAGTCAAGCCTTCATGAGCCC
ATGTACTATTTCCTCTCCATGCTATCCTTCTCAGACCTAGGATTATGCCTTTCCACATTG
GTCACCATGGTGGGTATTTTCTGGTTCAACACTCGAGAAATCAGCTTTGATGCCTGTATT
GGCCAAATGTTCTTCATCCATGGTTTTACCTTAATGGAGTCCTCGGTACTCCTTGCAATG
GCCTTTGATCGATACATTGCCATCTGTAATCCACTGAGATATGCCACAATCTTAACCAAT
TCAACGATCATCAAAGTGGGCTTTGCCATTGTTGTTCGGGTGACAACAGTTGTAGTGCCT
TTACTCCTGCTCCTTAAGCGTCTGTCCTTCTGTGGAAGTCATGTTCTGCACCATTCATAT
TGCTTCCACCCTGATGTGATGAAGCTTTCATGCACAGACACCAGGATCAACAGTGCATTT
GGTCTGGCCATCGTCATCTCTACCGCTGCCTTGGACTCTGTCTTGATCCTCCTCTCCTAT
GTCCTGATCATCCGCTCCGTGCTCAACATTGCCTCCCCAGAAGAGCGGAAAAAGGCCTTT
GGAACATGTGTATCCCACACAAGTGCCGTTGCCATCTTCTACATCCCCACGATCAGCTTG
TCACTGGTGCATAGATTTGGGAAGCACGCCCCTCCCCTTGTGCATACTCTCATTGCCAAC
ATGTATCTGCTCATCCCTCCTGTAATGAATCCCATAATCTACAGTGTGAAGACAAAGCAA
ATTCGCAAGGCCATGGTCAAAATATTCCTTTCCAAGCTAATT


Conceptual translation

MPSFNQSTFHPTVFFLTGIPGFETYHAWIFIPFCCLYVIAISGNGMILFIIITESSLHEP
MYYFLSMLSFSDLGLCLSTLVTMVGIFWFNTREISFDACIGQMFFIHGFTLMESSVLLAM
AFDRYIAICNPLRYATILTNSTIIKVGFAIVVRVTTVVVPLLLLLKRLSFCGSHVLHHSY
CFHPDVMKLSCTDTRINSAFGLAIVISTAALDSVLILLSYVLIIRSVLNIASPEERKKAF
GTCVSHTSAVAIFYIPTISLSLVHRFGKHAPPLVHTLIANMYLLIPPVMNPIIYSVKTKQ
IRKAMVKIFLSKLI