Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR51L1 Olfactory Receptor

Gene Symbol OR51L1
Organism Cow
Family 51
Subfamily L
Pseudo No
Location chr15:50687366-50688310 (-)
Aliases LOC107133172, ENSBTAG00000046627

Sequence information


Nucleotide sequence

ATGGTGGTCTGGAATAACAGTGATACTATGGAACCTATATTTATTCTGAGGGGTTTTCCT
GGACTGGAGTATGTTCATTCACATCTCTCCATCCCATTCTGCCTCGCATATTTGTTAGCA
TTTATTGGTAATGCTACCGTCCTCTCTGTTATTTGGACAGAGTCCTCACTCCACCAGCCC
ATGTATTACTTTCTCTCTATGTTGGCACTAACTGACCTAGGTATGTCCTTGTCCACACTG
CCCACCATGCTTGCTGTATTGTGTTTGGATGTTCGGGAGATCCAGGCAAGTGCTTGCTAT
GCCCAGCTCTTCTTCATCCACACTTTCACATTCCTGGAGTCCTCAGTGCTGCTGGCCATG
GCCTTCGACCGCTTTGTTGCTATTTGCCATCCACTGCACTACACCACCATCCTCACCAAC
AGTGTAATAGGCAAGGTTGGTTTGGCCTGCTTGCTGAAAAGCATGGGAGTTGTACTACCC
ACACCTTTGCTGCTGAGACACTATCACTGCTGCCATGCCAGTGCCCTCTCCCATGCCTTC
TGTTTGCACCAGGATGTTCTGAAGTTATCCTGTTCAGGTGCCAGGATCAGCAGTGTTTAT
GGACTGAGTGTAGTTATTGCCACACTGGGCGTGGATTCTGTCTTTATACTTCTTTCTTAT
GTCCTGATTCTGAAGGCTGTGCTGGGCATCGCCTCTCATGAGGAGCAGCTAAAGGCACTC
AACACATGTGTGTCTCATATGTGTGTGGTGCTCATCTTCTTTGTGCCAGTTATTGGGGTA
TCAATGGTCCATCGCTTTGGGAAGCATTTGTCTCCCATAATCCACATCCTTATGGCGGAC
ATATACCTGCTTCTTCCCCCAGTGCTTAACCCTGTTGTCTACAGCATCAGGACAAAGCAG
ATTCGTCTAGGAATTCTCTGCAAGTTTGGGATAAGGAGGAGGTTT


Conceptual translation

MVVWNNSDTMEPIFILRGFPGLEYVHSHLSIPFCLAYLLAFIGNATVLSVIWTESSLHQP
MYYFLSMLALTDLGMSLSTLPTMLAVLCLDVREIQASACYAQLFFIHTFTFLESSVLLAM
AFDRFVAICHPLHYTTILTNSVIGKVGLACLLKSMGVVLPTPLLLRHYHCCHASALSHAF
CLHQDVLKLSCSGARISSVYGLSVVIATLGVDSVFILLSYVLILKAVLGIASHEEQLKAL
NTCVSHMCVVLIFFVPVIGVSMVHRFGKHLSPIIHILMADIYLLLPPVLNPVVYSIRTKQ
IRLGILCKFGIRRRF