Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR52A1DP Olfactory Receptor

Gene Symbol OR52A1DP
Organism Cow
Family 52
Subfamily A
Pseudo Yes
Location chr15:***************** (-)
Aliases LOC781244

Sequence information


Nucleotide sequence

ATGTCCATTTCCAACATCACAGTCTTCATGCCTTCTGTGTTCATGCTAATAGGGATCCCA
GGCCTGGAGTCTGTGCAGTGCTGGATTGGGATTCCATTCTGTGCCATGTATCTCACTGCT
GTAATTGGAAATGCCTTGCTTCTGATCATCATCAAATCGGAGCCCAGCCTCCATGAACCC
ATGTACATTTTCCTGGGTATGCTAGGAGTCACAGATATTGCTCTTAGCACCAGCATTGTG
CCCAAAATGCTTGGAATCTTCTGGTTTCATATACCAGAGATATATTTTGACTCTTGCCTG
CTTCAAATGTGGCTCATTCACACATTTGAAGCCTTTGAGTCAGGCTTCCTCCTGGCCATG
GCCCTGGACCGCTGTGTGGCCATCTGTTATCCACTGAGACATGCTTCCATCTTCACCCCC
CAGCTAGTCACCCAAATAGCAGCTATGGTAACACTCAGGGCTACCATTTTTGTGACCCCC
AGCCTAGTACTGATAAAATACCAGCTGCACTTTTTTCATACAAAAGTTATCTCCCACTGC
TACTGTGAGCATATGGCCATTGTGAAACTGGCTGCAGAAGATGCCAGGGTCAACAAAATC
TATGGTTTGTTTGTGGCTTTCACTGTTGCTGGGTTTGACCTCATATGCATCTCATTGTCC
TATGTACAGATATTTATCACAGTTTTTCGTTTGCCCTAGAAGGAGGCTAGGTTGAAAGCA
TTCAATACTTGCATCGCTCACATCTGTGTCTTCCTCCAGTTCTACCTCCTTGCCTTCTTC
TCTTTCTTTACACATAGGTTTCGTTCTCACATCCCCCCTTACATCCACATCCTCTTTTCT
AGCATTTACTTGCTGGTCCCTCCATTTCTCAATCCACTTGTCTATGGTGCAAAAACCAAG
CAGATTTGCATTCATGTGGTAAAAATATTCTCTTTT


Conceptual translation

MSISNITVFMPSVFMLIGIPGLESVQCWIGIPFCAMYLTAVIGNALLLIIIKSEPSLHEP
MYIFLGMLGVTDIALSTSIVPKMLGIFWFHIPEIYFDSCLLQMWLIHTFEAFESGFLLAM
ALDRCVAICYPLRHASIFTPQLVTQIAAMVTLRATIFVTPSLVLIKYQLHFFHTKVISHC
YCEHMAIVKLAAEDARVNKIYGLFVAFTVAGFDLICISLSYVQIFITVFRLP*KEARLKA
FNTCIAHICVFLQFYLLAFFSFFTHRFRSHIPPYIHILFSSIYLLVPPFLNPLVYGAKTK
QICIHVVKIFSF