Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR52A5D Olfactory Receptor

Gene Symbol OR52A5D
Organism Cow
Family 52
Subfamily A
Pseudo No
Location chr15:***************** (+)
Aliases LOC789144

Sequence information


Nucleotide sequence

ATGCTCAGACCCAATGGCTCAGTCTTCACGCCCTCTGTACTAACACTCATCGGGATTCCT
GGCCTGGAGTCAGTGCAGTGTTGGATCGGGATTCCATTCTGTTTCATGTACCTTATGGCA
GTGATTGGGAATACATTAATTTTAGTGATAATCAAATATGAAAACAGCCTTCATAGTCCA
ATGTACATTTTTCTGGCCATGTTGGGGGCCACAGACATTGCACTTAGCACATGTATTCTT
CCCAGAATGTTAGGCATCTTTTGGTTTCACTTGACAGAGATTTCCTTTGATGCCTGTCTT
CTACAAATGTGGCTTATTCACTCATTCCAGGCAACCGAATCAGGTGTTTTACTGGCCATG
GCCCTAGATCGCTATGTGGCCATCTGTAACCCCTTGAGACATGCCAGCATCTTCTCCCAA
AAACTCTTGACTCACATTGGAATCGGTGTAGTACTCAGGGCTATCGTTCTTGTAGCACCA
TGCATAGTGCTTATCAAATATCGTCTTAAATTCTACCGAACCACAGTCATCTCCCACTCT
TACTGTGAGCACATGGCCATTGTGAAACTGGCTACTGAAGATATACGGATCAACAAGATA
TTAGGCCTGTTTGTTGCCTTCACTATCTTAGGATTTGATATCAGCTTTATTACTTTGTCC
TATTTTCAGATTTTTGTCACTGTCTTTCAACTGCCCCAGAAGGAAGCAAGATTGAAAGCC
TTTAATACATGCATCGCTCATATTTGTGTCTTCCTGCAGTTCTACCTCCTTGGCTTCTTC
TCTTTCTTCACACACAGGTTTGGTTCTCACATACCACCATACGTTCACATCCTTTTATCT
AGCCTTTACCTTTTAGTTCCACCTTTTCTCAACCCAATCGTCTATGGAGTGAAGACCAAA
CAAATTCGTGACCGTGTCCTGAAAATGATCTTCTCCAAAAGACATCCTGATCAT


Conceptual translation

MLRPNGSVFTPSVLTLIGIPGLESVQCWIGIPFCFMYLMAVIGNTLILVIIKYENSLHSP
MYIFLAMLGATDIALSTCILPRMLGIFWFHLTEISFDACLLQMWLIHSFQATESGVLLAM
ALDRYVAICNPLRHASIFSQKLLTHIGIGVVLRAIVLVAPCIVLIKYRLKFYRTTVISHS
YCEHMAIVKLATEDIRINKILGLFVAFTILGFDISFITLSYFQIFVTVFQLPQKEARLKA
FNTCIAHICVFLQFYLLGFFSFFTHRFGSHIPPYVHILLSSLYLLVPPFLNPIVYGVKTK
QIRDRVLKMIFSKRHPDH