Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR52B28P Olfactory Receptor

Gene Symbol OR52B28P
Organism Cow
Family 52
Subfamily B
Pseudo Yes
Location chr15:48,589,900-48,590,600 (-)

Sequence information


Nucleotide sequence

CTTCACTCTCACTTCCTTTTTGTGGCTGAGTCTGCAGTCCTCCTGGCCATGGCCTTTGAC
CGTTATGTGGCCATCTGCTCCCCTTTGAGATATGCCACAATCCTCACCAGCAGAACCATT
GGGAAGATCGTGGCTGCCACACTGGCCCGCAGCTTCATCATCATGTTTCCATCTATCTTT
CTTCTCAAGCGCCTGCACTACTGCCGGGTCAATATCATTGCGCACACATTTTGTGAGCAC
ATGGGCATTGCCCGTCTGTCCTGTTCTGATATCTCCATCAACGTCTGGTATGGCTTGGCA
GCTGCTCTGCTCTCCACTGGCCTGGACATCATCCTTATTGCTGTTTCCTACATTCACATC
CTCCGAGCTGTCTTCCACCTCTCCTCTCAAGATGCCCGGTCCAAAGCCCTGAGCACTTGT
GGCTCCCACATCTGCGTCATCTTACTCTTCTACATCCCTGCACTCTTTTCTGTCTTTGCC
TATAGGTTTTGGGGGAGACACATCCCACGCTATGTTCATATCCTCCTGGCCAATCTCTAT
GTGGTCATCCCACCTATGCTCAATCCCATTATTTATGGAGTGAGGACCAAGCAGATCTTG
GAAGGGGCTAAACAGCTGTTTTCATATCTTATCAAAGAATCTAAA


Conceptual translation

M/LHSHFLFVAESAVLLAMAFDRYVAICSPLRYATILTSRTIGKIVAATLARSFIIMFP
SIFLLKRLHYCRVNIIAHTFCEHMGIARLSCSDISINVWYGLAAALLSTGLDIILIAVSY
IHILRAVFHLSSQDARSKALSTCGSHICVILLFYIPALFSVFAYRFWGRHIPRYVHILLA
NLYVVIPPMLNPIIYGVRTKQILEGAKQLFSYLIKESK