Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR52D1D Olfactory Receptor

Gene Symbol OR52D1D
Organism Cow
Family 52
Subfamily D
Pseudo No
Location chr15:48,747,000-48,748,100 (-)

Sequence information


Nucleotide sequence

ATGAACCAGATCTCTCATGCTGCAGGACAGGTGTACCTTCAGCCCTTGGACAAAGCCCTT
TATTTGCCAAGCAGAATGCCAGCATTCAACATTAGCGATGACCATCTCCCAGCCACTCTC
TTCCTGACAGGGATCCCAGGGCTGGAGTGGGCTCATGTCTGGATTGCCATCCCCTTTTGT
GCCATGTATATAGTAGCACTGGCTGGGAATGCCACCCTCATCCTGATCATAGTGACAGAC
AGTGCCCTTCATGCGCCCATGTACCTCTTCCTTTGCCTCCTCTCACTCACTGACCTGGCT
CTCAGCTCCACCACTGTGCCCAAAATGTTGGCTATTTTGTGGTTCCAAGCAGGTGAGATT
TCCTTTGATGGGTGCCTGGCCCAGATGTTTTGTGTCCATTCTATTTATGCTCTAGAGTCC
TCGGTTCTTCTTGCCATGGCCTTTGATCGATACGTGGCAATCTGCAACCCACTGAGATAC
ACAACCATCCTCAACCATGCTGTCATAGGTAGAATCGGCCTTGTGGGTATATTCAGGAGT
ATAGCTGTTGTCTCCCCCTTCATCTTCCTGTTGAGGCGACTGCCCTACTGTCAGCACCAT
GTCATGGCACACACATACTGTGAGCACATGGGCATTGCTCGACTGGCCTGTGCAAACATC
ACTGTCAATATAGTCTATGGGCTAACTGTGGCCCTTCTGGCTGTGGGTCTGGATTCCATC
CTCATTGCCGTTTCCTATGGCTTTATTCTCCATGCTGTCTTTCGTCTTCCATCTCAAGAT
GCCAGGCGCAAGGCTCTGAGTACCTGTGGCTCCCACCTTGGTGTCATCCTGGTCTTCTAC
ATCCCTGCCTTCTTCTCCTTTCTCACCCACCGTTTTGGCCAACACCGAGTCCCCAGGCAC
GTGCACATCTTTCTGGCTAATCTCTATGTTCTGGTGCCTCCTGTGCTCAACCCAATCATC
TATGGGGCTAGGACCAAGGAAATTCGGAGTCGACTTCCAAGACTGCCTCACTTGTGGAGG
GTCTCAGTA


Conceptual translation

MNQISHAAGQVYLQPLDKALYLPSRMPAFNISDDHLPATLFLTGIPGLEWAHVWIAIPFC
AMYIVALAGNATLILIIVTDSALHAPMYLFLCLLSLTDLALSSTTVPKMLAILWFQAGEI
SFDGCLAQMFCVHSIYALESSVLLAMAFDRYVAICNPLRYTTILNHAVIGRIGLVGIFRS
IAVVSPFIFLLRRLPYCQHHVMAHTYCEHMGIARLACANITVNIVYGLTVALLAVGLDSI
LIAVSYGFILHAVFRLPSQDARRKALSTCGSHLGVILVFYIPAFFSFLTHRFGQHRVPRH
VHIFLANLYVLVPPVLNPIIYGARTKEIRSRLPRLPHLWRVSV