Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR52E4 Olfactory Receptor

Gene Symbol OR52E4
Organism Cow
Family 52
Subfamily E
Pseudo No
Location chr15:47,772,000-47,772,900 (-)

Sequence information


Nucleotide sequence

ATGCCTTCTATCAATGACACCCAGTTCCATCCTCCCTTCTTTCTCCTGCTAGGAATACCA
GGGCTGGAGACTGTACATATCTGGATTGCTTTCCCATTCTGTGTTGTGTATCTGATTGCC
CTTGTGGGGAACATCACTGTTCTATATGTGATCAAGACTGAACACAGTCTCCACCAGCCC
ATGTTCTACTTTCTGGCCATGTTGTCCATGATTGATCTGGGTCTGTCCACCTCCACCATC
CCCAAAATGCTGGGCATCTTCTGGTTCAACCTCAAAGAGATCAGCTTTGGAGGCTGCCTT
GCTCAGATGTTCTTTATCCACATGTTTACAGGAATGGAGACTGTTCTACTGGTGGCCATG
GCTTATGACCGCTTTGTTGCCATCTGCAACCCCCTCCAGTACACCACCATCCTCACCAGT
AAAACCATCGGCATTTTAGCCTCTGTTGTTGTGGGCAGAAATTTACTTCTTGTGACTCCA
TTTGTGTTTCTCATTCTGAGGCTGCCCTTCTGTGGGCACCACATTGTTCCCCATACATAC
TGTGAGCACATGGGTCTTGCCCGATTGGCCTGTGCATCCATTAAGATCAATGTTATCTAT
GGGCTCATGGTGATTTCTAATATTATTGTAGATGTGATTCTGATTGCCTCTTCCTATGTA
CTGATCCTTCAAGCTGTTTTCCACCTCCCCTGTCAGGATGCCCGACTGAAGGCTCTCAAT
ACCTGCGGTTCTCACGTCTGTGTCATGCTGTGCTTTTACACACCAGCATTTTTTTCTTTT
ATGACACACCGCTTTGGTCGTAATATTCCCCACTACATTCACATTCTTTTGGCTAATCTA
TATGTGGTTGTCCCACCTGCCCTTAACCCAGTCATCTATGGAGTCAGGACAAAGCAAATC
CGAGAGCGGGTTGTAAAAATATTTATA


Conceptual translation

MPSINDTQFHPPFFLLLGIPGLETVHIWIAFPFCVVYLIALVGNITVLYVIKTEHSLHQP
MFYFLAMLSMIDLGLSTSTIPKMLGIFWFNLKEISFGGCLAQMFFIHMFTGMETVLLVAM
AYDRFVAICNPLQYTTILTSKTIGILASVVVGRNLLLVTPFVFLILRLPFCGHHIVPHTY
CEHMGLARLACASIKINVIYGLMVISNIIVDVILIASSYVLILQAVFHLPCQDARLKALN
TCGSHVCVMLCFYTPAFFSFMTHRFGRNIPHYIHILLANLYVVVPPALNPVIYGVRTKQI
RERVVKIFI