Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR52H1D Olfactory Receptor

Gene Symbol OR52H1D
Organism Cow
Family 52
Subfamily H
Pseudo No
Location chr15:48,672,700-48,673,600 (+)

Sequence information


Nucleotide sequence

ATGGTCCTTTTCAACCTGAGCAGTGACAACCCAGGACCCTTCATTCTGGTGGGGATCCCA
GGCCTGGAGCAAGCCCATGTGTGGATTGGAATTCCCTTCTGTATCATCTATATTGTAGCC
ATTGTGGGAAACTGCATCCTTCTCTACCTAATCTTAGTGGAGCGTAGCCTTCACGAACCC
ATGTTCTTCTTTCTCTCCATGCTGGCCAAGACTGACCTCACCTTGTCCACAGCTGGTATT
CCTAAAACACTGAGTATCTTTTGGCTTGGGGCTCGAGAGATCACATTCCCAGGGTGCCTC
ACACAAATGTTCTTCCTCCACTACAGCTTCGTCCTGGATTCAGCCATCCTGATGGCCATG
GCATTTGACCGCTATGTGGCCATCTGCTCTCCCTTGAGATACAACTCTATCTTGACCCCC
AAGACCATCATCAAGATTGTGGTGGGAATCTCCTTTCGTAGTTTCTGCATCATCCTGCCT
GATGTATTCTTGCTCATACGACTGCCTTTCTGTAGGACACGCATCATACCGCACACATAC
TGTGAGCACATAGGTGTTGCCTGGCTCGCCTGTGCGGACATCTCCATCAACATCTGGTAT
GCCTTTTGCATTCCCATCATGACAGTCATCTCAGATGTGATCCTCATTGCCGTTTCTTAC
ACACTCATCCTCTGTGCTGTCTTCCGCCTCCCCTCCTATGAAGCCCGCCAGAAGGCCCTG
GGCACCTGTGGTTCCCATGTCTGTGTCATCCTCATGTTTTATACACCTGCCTTTTTCTCC
ATCCTTGCCCACCGCTTTGGACACAATGTCTCCCGCACTTTCCACATCATGTTTGCTAAC
CTCTACATTGTTATCCCACCTGCACTCAACCCCATTGTTTATGGAATGAAGACCAAGCAG
ATCAGAGAGAAGGTCATCATTTTCTTTTCTATCAAGGGTACATTATGGAAATGT


Conceptual translation

MVLFNLSSDNPGPFILVGIPGLEQAHVWIGIPFCIIYIVAIVGNCILLYLILVERSLHEP
MFFFLSMLAKTDLTLSTAGIPKTLSIFWLGAREITFPGCLTQMFFLHYSFVLDSAILMAM
AFDRYVAICSPLRYNSILTPKTIIKIVVGISFRSFCIILPDVFLLIRLPFCRTRIIPHTY
CEHIGVAWLACADISINIWYAFCIPIMTVISDVILIAVSYTLILCAVFRLPSYEARQKAL
GTCGSHVCVILMFYTPAFFSILAHRFGHNVSRTFHIMFANLYIVIPPALNPIVYGMKTKQ
IREKVIIFFSIKGTLWKC