Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR52I11 Olfactory Receptor

Gene Symbol OR52I11
Organism Cow
Family 52
Subfamily I
Pseudo No
Location chr15:51,071,800-51,072,900 (-)

Sequence information


Nucleotide sequence

ATGCTGGGGTTACCCTACAACCATACAACGGAAGCCCCTGCCACCTTCATCCTGGTGGGT
ATCCCAGGTTTGCAGTCTTCACATCTTTGGCTGGCTGTCTCACTGAGCATCATGTATACC
ACAGCCCTGTTAGCAAACACCCTCATAGTGACTATCATCTGGATGGATTCCACTCTACAG
GAGCCCATGTACTGCTTCCTGTGTGTTCTGGCTGCCGTGGACATGGTGATGGCCTCCTCG
GTGGTGCCCAATATGGTGAGCATCTTCTCCTCAGGAGACAACACCATCAGCTTTAATGCT
TGTTTCACTCAGATGTATCTTGTCCATGCAGCCACAGCTGTGGAGTCGGGGCTGCTGCTG
GCCATGGCTTTTGACCGCTATGTGGCCATCTGTAAGCCCCTACACTATAAGAGAATTCTC
ACACCTCGAGTGATGCTGGAAATGACTGTGATCATCAGCATCAGAGCGACTGTATTCATG
ACTCCCCTGAGCTGGATGGTGAGTCATCTGCCCTTCTGTGGCTCCAACGTGGTTCTCCAT
TCCTACTGTGAGCACATAGCTGTGGCCAAGTTGACTTGTGCCGACCCCAGGCCCAGTAGT
CTTTATAGCCTGATTGTTTCCTCCATTATTGTGGGTTCTGATGTGGCCTTTATTGCTGCC
TCCTATATCCTGATTCTCCAGGCAGTATTCAGTCTCTCCTCAAAGAATGCTCAGTTAAAA
GCATTAAGCACATGTGGCTCCCATGTGGGGGTTATGGCTCTGTACTACCTGCCTGGGATG
GCGTCCATCTATGTGGCCTGGCTGGGGGAGGATGTAGCGCCTTTGTGCACCCAAGTGCTG
TTAGCTGACTTGTATCTGATCATCCCGCCATCTTTGAACCCCATCATCTATGGCCTAAGG
ACGAAGCAAATACGGAAGCGAACATGGGGCCTGCTGATTCACTACCTCTTTAACCACTCC
AACTTGGGCTCAGGAATTCAGGCCCTTGAGCAAACCAGACAACTTCAAAGACTCCCTAGC


Conceptual translation

MLGLPYNHTTEAPATFILVGIPGLQSSHLWLAVSLSIMYTTALLANTLIVTIIWMDSTLQ
EPMYCFLCVLAAVDMVMASSVVPNMVSIFSSGDNTISFNACFTQMYLVHAATAVESGLLL
AMAFDRYVAICKPLHYKRILTPRVMLEMTVIISIRATVFMTPLSWMVSHLPFCGSNVVLH
SYCEHIAVAKLTCADPRPSSLYSLIVSSIIVGSDVAFIAASYILILQAVFSLSSKNAQLK
ALSTCGSHVGVMALYYLPGMASIYVAWLGEDVAPLCTQVLLADLYLIIPPSLNPIIYGLR
TKQIRKRTWGLLIHYLFNHSNLGSGIQALEQTRQLQRLPS