Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR52J3 Olfactory Receptor

Gene Symbol OR52J3
Organism Cow
Family 52
Subfamily J
Pseudo No
Location chr15:50,536,000-50,536,900 (+)

Sequence information


Nucleotide sequence

ATGTTTTATCACAATAGTAGCATTTTTCACCCAACCACATTTTTCCTCATTGGAATCCCA
GGTCTGGAAGAGGTCCATGGCTGGATCTCCCTGCCTTTCTGCTCTGTTTACCTTGTGGCT
TTACTGGGAAATGTCACAATTTTGCTGGTCATCAAGACAGAGGAGACCCTCCAGGAGCCC
ATGTTCTACTTCCTGGCCATCCTTTCAACAATTGATTTGGCCCTTTCAACAACCTCAGTA
CCCCGTATGCTGGGTATCTTCTGGTTTGATGCTCACGAGATTAGTTTTGGAGCTTGTGTG
GCCCAGATGTTCCTGATCCATGCTTTTACTGGCATGGAAGCTGAAGTCTTGCTGGCGATG
GCCTTTGACCGCTATGTGGCGATCTGTGCTCCACTCCACTACACGACCATTTTGACATCC
CGGGTGCTCATGGGCATCAGCATGTGCATTGTAATTCGTCCAGTTCTGCTTACACTTCCC
ATGATCTATCTCGTCTATCGCCTACCATTTTGCCAGGCTTATATAATACCTCATTCCTAC
TGTGAACACATGGGAATTGCAAAACTGTCCTGTGGAAATATCCGAATTAATGATATCTAT
GGACTTTTTGTTGTTTCCTTCTTTTTCCTAAACCTAGTCCTTATTGGCATCTCCTATGTT
TATATTCTCAGGGCTGTCTTCCGTCTCCCATCCCAAGATGCACGACTAAAAGCCCTAAGC
ACATGTGGGTCCCATATTGGGGTCATCTGTATTTTCTGTATCCCTTCAGTCTTCTCCTTC
CTTACCCACCGATTTGGACACAAAATACCTCGCTATATTCATATTCTTGTTGCCAACCTC
TATTTGATTATCCCACCCTCACTCAACCCCATCATTTATGGTATAAAGACCAAACAGATA
TGGCAGCCTGTGCTCCGTGCCTTTATTAAAAAA


Conceptual translation

MFYHNSSIFHPTTFFLIGIPGLEEVHGWISLPFCSVYLVALLGNVTILLVIKTEETLQEP
MFYFLAILSTIDLALSTTSVPRMLGIFWFDAHEISFGACVAQMFLIHAFTGMEAEVLLAM
AFDRYVAICAPLHYTTILTSRVLMGISMCIVIRPVLLTLPMIYLVYRLPFCQAYIIPHSY
CEHMGIAKLSCGNIRINDIYGLFVVSFFFLNLVLIGISYVYILRAVFRLPSQDARLKALS
TCGSHIGVICIFCIPSVFSFLTHRFGHKIPRYIHILVANLYLIIPPSLNPIIYGIKTKQI
WQPVLRAFIKK