Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR52J3DP Olfactory Receptor

Gene Symbol OR52J3DP
Organism Cow
Family 52
Subfamily J
Pseudo Yes
Location chr15:50,649,500-50,650,400 (-)

Sequence information


Nucleotide sequence

ATTTTTTAATAAATGCACGGAGTACAGGCTCCCATATCTGTTTGGTCTTTATACCATAAA
TGATGGGGTTGAGTGAGGGTGGGATAATCAAATAGAGGTTGGCAACAAGAATATGAATAT
AGCGAGGTATTTTGTGTCCAAATCTGTGGGTAAGGAAAGAGAAGACTGAGGGGATATAGA
AAACACAGATGACCCCAATATGGGACCCACATGTGCTTAGGGCTTTTAGTCGTGCATCTT
GGGATGGGAGACAGAAGACAGCCCAGAGAATATAAACATAGGAGATGCCAATAAGGACTA
GGTTTAGGACAAAGAAGGAAACAACAAAAAGTCCATAGATACCATTAATTCGGATATTTC
CACAGGACAGTTTTGCAATTCCCATGTGTTCACAGTAGGAATGAGGTATTATATAAGTCT
GGCAAAATGGTAGGCGATAGATGAGATAGATCATGGGAAGTGTAAGCAGAACTGGACGAA
TTACAATGCACATGCTGATGCCATGAGCACCCGGGATGTCAAAATGGTCGTGTAGTGGAG
TGGAGCACAGATCGCCACATAGCGGTCAAAGGCCATCGCCAGCAAGACTTCAGCTTCCAT
GCCAGTAAAAGCATGGATCAGGAACATCTGGGCCACACAAGCTCCAAAACTAATCTCGTG
AGCATCAAACCAGAAGATACCCAGCATACGGGGTACTGAGGTTGTTGAAAGGGCCAAATC
AATTGTTGAAAGGATGGCCAGGAAGTAGAACATGGGCTCCTGGAGGGACTTCTCTGTCTT
GATGACCAGCAAAATTGTGACATTTCCCAGTAAAGCCACAAGGTAAACAGAGCAGAAAGG
CAGGGAGATCCAGCCATGGACCTCTTCCAGACCTGGGATTCCAATGAGGAAAAATGTGGT
TGGGTGAAAAATGCTCCTATTGTGATAAAACAT


Conceptual translation

MFYHNRSIFHPTTFFLIGIPGLEEVHGWISLPFCSVYLVALLGNVTILLVIKTEKSLQEP
MFYFLAILSTIDLALSTTSVPRMLGIFWFDAHEISFGACVAQMFLIHAFTGMEAEVLLAM
AFDRYVAICAPLHYTTILTSRVLMAS/MCIVIRPVLLTLPMIYLIYRLPFCQTYIIPHS
YCEHMGIAKLSCGNIRINGIYGLFVVSFFVLNLVLIGISYVYILWAVFCLPSQDARLKAL
STCGSHIGVICVFYIPSVFSFLTHRFGHKIPRYIHILVANLYLIIPPSLNPIIYGIKTKQ
IWEPVLRAFIKK