Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR52M1 Olfactory Receptor

Gene Symbol OR52M1
Organism Cow
Family 52
Subfamily M
Pseudo No
Location chr15:51392458-51393408 (+)
Aliases OR52M1, ENSBTAG00000031924

Sequence information


Nucleotide sequence

ATGCTCACTTTTCATAATGTCTGCTTAGCACCCAGTTCCTTCCAGCTGACTGGAATTCCA
GGACTGGAGTCCCTGCATATCTGGCTCTCCATCCCCTTCAGCTCCATGTACCTGGTAGCT
GTGGTGGGGAATGCCACCATTCTGGCTGTGGTAAGGGTGGAGCATAGCCTGCACCAGCCC
ATGTACTTCTTTCTGTGCATGTTGGCTATCATTGACCTGGTTCTGTCTACTTCCACTATG
CCCAAACTGCTGGGGATATTCTGGTTTGGGGCTGGTGATATTGGGTTGGATGCCTGCTTG
GCTCAGATGTTCCTCATTCACTGCTTTGCCACAGTGGAGTCAGGCATCTTCCTTGCCATG
GCTTTTGACCGCTATGTAGCCATCTGCAACCCACTCCATCATACCACAGTGCTCACTCAT
ACCATGGTGGGACGTTTGGGGATGGCTGCCCTCTGCCGGGGTGTCCTCTACATTGGACCC
CTGCCTCTGATGATCCGTCTACGGCTGCCTCTTTACAAAACCCGTGTTATCTCCCACTCC
TATTGTGAGCACATGGCTGTGGTCACCTTGACATGTGGTGACAGCAGGATCAACAATATC
TATGGATTGAGCATTGGCTTTCTGGTCCTGATCCTGGACTCAATGGCCATTACTGCCTCC
TATGTGATGATTTTCAGAACCGTGATAGGGCTGTCTACTCCTGAGGCCAGGCTGAAAACC
CTGGGGACGTGTGGTTCCCACATCTGTGCTATCCTGATCTTTTATGTTCCCATTGCTGTT
TCTTCCCTCATTCACCGATTTGGTCACCAGGTGCCCCCTCCAATCCACACCTTGCTGGCC
AACTTCTACCTCCTTATTCCTCCAATCCTCAATCCTATTGTCTATGCAGTCCGCACCAAG
CAGATCCGGGAAAGACTTCTCCAAATTCTCAAGACAGAAACTAAGATCAAA


Conceptual translation

MLTFHNVCLAPSSFQLTGIPGLESLHIWLSIPFSSMYLVAVVGNATILAVVRVEHSLHQP
MYFFLCMLAIIDLVLSTSTMPKLLGIFWFGAGDIGLDACLAQMFLIHCFATVESGIFLAM
AFDRYVAICNPLHHTTVLTHTMVGRLGMAALCRGVLYIGPLPLMIRLRLPLYKTRVISHS
YCEHMAVVTLTCGDSRINNIYGLSIGFLVLILDSMAITASYVMIFRTVIGLSTPEARLKT
LGTCGSHICAILIFYVPIAVSSLIHRFGHQVPPPIHTLLANFYLLIPPILNPIVYAVRTK
QIRERLLQILKTETKIK