Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR56A4D Olfactory Receptor

Gene Symbol OR56A4D
Organism Cow
Family 56
Subfamily A
Pseudo No
Location chr15:47,629,000-47,629,900 (+)

Sequence information


Nucleotide sequence

ATGGGATTACCCAGCAACTACACCACTGCTCCAGTCTCAGAATTTCTCCTCATCTGCTTC
CCTAACTACCAGAGCTGGCAGCATTGGCTGTCCCTGCCCCTCACTCTCCTCTTCCTCCTG
GCCATGGGGGCCAATGCCACCCTCCTGGTCACCATCCGGCTGGAGGCCTCTCTGCATGAG
CCCATGTACTACCTGCTCAGCCTCCTCTCCCTGCTGGACATGGTGCTCTGCCTCACTGTC
ATCCCCAAGGTCCTGGCCATCTTCTGGTTTGACAATAAAGCCATCAGTTTCTCAGGCTGC
TTCTTCCAGATGTTTATCATGAATAGCTTCCTGACCATGGAGTCCTGTACATTCATGGTC
ATGGCCTATGACCGCTATGTGGCCATCTGCCACCCATTAAGGTACCCGTCCATTATCACT
GACCAATTTGTAGCTAGGGCTGCCATTTTTGTTGTGGCCCGGAATGGCCTTCTTACTATG
CCTATCCCCATACTTTCTTCCCGACTGAGATACTGTGCAGAGAACATCATCAAGAACTGC
ATCTGCACTAACCTGTCTGTGTCCAAACTCTCCTGTGATGACATCACCTTCAATCGGCTC
TACCAGTTTGTGGCAGGCTGGACCCTACTGGGCTCTGACCTCATCCTTATCATTCTCTCC
TACTCTTTTATCCTGAAAGTTGTGCTAAGGATTAAAGCTGAGGGAGCTGCTGCCAAGGCC
CTGAGCACCTGTGGTTCCCACTTCATCCTCATCCTCTTCTTCAGCACAGTCCTGCTGGTC
CTAGTCATCACTAACCTGGCCAGGAAGAGGATTCCCCCAGATGTCCCCATCCTGCTCAAC
ATCCTGCACCACCTCATCCCCCCAGCTCTGAACCCCATTGTTTATGGTGTGAGAACCAAG
GAGATCAAGCAGGAAATCCAGAAACTGCTCAGGAGGTTA


Conceptual translation

MGLPSNYTTAPVSEFLLICFPNYQSWQHWLSLPLTLLFLLAMGANATLLVTIRLEASLHE
PMYYLLSLLSLLDMVLCLTVIPKVLAIFWFDNKAISFSGCFFQMFIMNSFLTMESCTFMV
MAYDRYVAICHPLRYPSIITDQFVARAAIFVVARNGLLTMPIPILSSRLRYCAENIIKNC
ICTNLSVSKLSCDDITFNRLYQFVAGWTLLGSDLILIILSYSFILKVVLRIKAEGAAAKA
LSTCGSHFILILFFSTVLLVLVITNLARKRIPPDVPILLNILHHLIPPALNPIVYGVRTK
EIKQEIQKLLRRL