Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR56A4E Olfactory Receptor

Gene Symbol OR56A4E
Organism Cow
Family 56
Subfamily A
Pseudo No
Location chr15:47,734,600-47,735,600 (-)

Sequence information


Nucleotide sequence

ATGGCATCACACAGCAACTATTCCGCTCCCCCAGTCTCCGAATTCATCCTCATCTGCTTC
CCTAACTACCAGAGCTGGCAGCACTGGCTGTCCCTGCCCCTCAGTCTCCTTTTGCTCCTG
GCTCTGGGGGCCAATGCCACCCTCCTCATCACCATCTGGCTGGAGGCCTCTCTGCATGAG
CCCATGTACTACCTGCTCAGCCTCCTCTCCCTGCTGGACATGGTGCTCTGTCTCACCGTC
ATCCCCAAGGTTCTAGCCATCTTCTGGTTTGACCTCAGGTCTATTGGGTTTTTTCCCTGC
TTTCTTCAGATGTTCATCATGAACAGTTTCTTGACCATGGAGTCCTGCACATTCATGGTC
ATGGCCTATGACCGCTATGTGGCCATCTGCAAGCCTCTGCACTACCCATCTATCATCACT
AACCAATTTGTGGCCAGAGCCACCATTTTTGTAGTGGCCCGGAATGCCCTTGCTTCACTC
CCAGTTCCAATCCTTTCTGCCAGACTCAGATATTGTGCAGAGAACATCATCAAGAACTGC
ATCTGCACTAATCTGTCTGTGTCCAAACTCTCCTGTGATGACATCACCTTCAATCAGCTC
TACCAGTTTGTGGCAGGCTGGACCCTACTGGGCTCTGACCTCATTCTTATCATTATCTCC
TACTCTTTTATCCTGAAAGCTGTTCTAAGGATTAAAGCTGAGGGAGCTGCTGCCAAGGCC
CTGAGCACCTGTGGTTCCCACTTCATCCTCATCCTCTTCTTCAGCACAGTCCTGCTGGTC
CTGGTCATCACTAACCTGGCCAGGAAGAGGATTCCCCCAGACGTCCCCATCCTGCTCAAC
ATTCTGCACCACCTCATCCCCCCAGCTCTGAACCCCATAGTTTATGGTGTGAGAACCAAG
GAGATAAAGCAGGGAATCCAGAAAATGATCAGGAGGTTA


Conceptual translation

MASHSNYSAPPVSEFILICFPNYQSWQHWLSLPLSLLLLLALGANATLLITIWLEASLHE
PMYYLLSLLSLLDMVLCLTVIPKVLAIFWFDLRSIGFFPCFLQMFIMNSFLTMESCTFMV
MAYDRYVAICKPLHYPSIITNQFVARATIFVVARNALASLPVPILSARLRYCAENIIKNC
ICTNLSVSKLSCDDITFNQLYQFVAGWTLLGSDLILIIISYSFILKAVLRIKAEGAAAKA
LSTCGSHFILILFFSTVLLVLVITNLARKRIPPDVPILLNILHHLIPPALNPIVYGVRTK
EIKQGIQKMIRRL